PDB entry 1ydr

View 1ydr on RCSB PDB site
Description: structure of camp-dependent protein kinase, alpha-catalytic subunit in complex with h7 protein kinase inhibitor 1-(5-isoquinolinesulfonyl)-2-methylpiperazine
Class: complex (phosphotransferase/inhibitor)
Keywords: complex (phosphotransferase/inhibitor), transferase, camp, phosphorylation, isoquinoline sulfonamide, serine/threonine-protein kinase, ATP-binding
Deposited on 1996-07-24, released 1997-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.188
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: c-amp-dependent protein kinase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00517 (Start-349)
      • conflict (123)
      • modified residue (196)
      • conflict (285)
      • modified residue (337)
    Domains in SCOPe 2.08: d1ydre_
  • Chain 'I':
    Compound: protein kinase inhibitor peptide
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IQP, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ydrE (E:)
    gnaaaakkgseqesvkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlv
    khmetgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvaggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydrE (E:)
    vkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamkil
    dkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvaggemfshlrr
    igrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgr
    twtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgk
    vrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfattdwiaiyqrkveapf
    ipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'I':
    No sequence available.