PDB entry 1ydo

View 1ydo on RCSB PDB site
Description: crystal structure of the bacillis subtilis hmg-coa lyase, northeast structural genomics target sr181.
Deposited on 2004-12-24, released 2005-07-05
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HMG-CoA Lyase
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: yngG
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34873 (0-End)
      • modified residue (0)
      • modified residue (101)
      • modified residue (218)
      • modified residue (224)
      • modified residue (257)
      • modified residue (261)
      • modified residue (283)
  • Chain 'B':
    Compound: HMG-CoA Lyase
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: yngG
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34873 (0-End)
      • modified residue (0)
      • modified residue (101)
      • modified residue (218)
      • modified residue (224)
      • modified residue (257)
      • modified residue (261)
      • modified residue (283)
  • Chain 'C':
    Compound: HMG-CoA Lyase
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: yngG
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34873 (0-End)
      • modified residue (0)
      • modified residue (101)
      • modified residue (218)
      • modified residue (224)
      • modified residue (257)
      • modified residue (261)
      • modified residue (283)
  • Chain 'D':
    Compound: HMG-CoA Lyase
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: yngG
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34873 (0-End)
      • modified residue (0)
      • modified residue (101)
      • modified residue (218)
      • modified residue (224)
      • modified residue (257)
      • modified residue (261)
      • modified residue (283)
  • Heterogens: IOD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ydoA (A:)
    mpypkkvtikevgprdglqnepvwiatedkitwinqlsrtglsyieitsfvhpkwipalr
    daidvakgidrekgvtyaalvpnqrglenaleggineacvfmsasethnrkninkstses
    lhilkqvnndaqkanlttraylstvfgcpyekdvpieqvirlsealfefgiselslgdti
    gaanpaqvetvleallarfpanqialhfhdtrgtalanmvtalqmgitvfdgsagglggc
    pyapgssgnaatedivymleqmdiktnvklekllsaakwieekmgkplpsrnlqvfkssl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1ydoA (A:)
    mpypkkvtikevgprdglqnepvwiatedkitwinqlsrtglsyieitsfvhpkwipalr
    daidvakgidrekgvtyaalvpnqrglenaleggineacvfmsasethnrkninkstses
    lhilkqvnndaqkanlttraylstvfgcpyekdvpieqvirlsealfefgiselslgdti
    gaanpaqvetvleallarfpanqialhfhdtrgtalanmvtalqmgitvfdgsagglggc
    pyapgssgnaatedivymleqmdiktnvklekllsaakwieekmgkplpsrnlqvfks
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1ydoB (B:)
    mpypkkvtikevgprdglqnepvwiatedkitwinqlsrtglsyieitsfvhpkwipalr
    daidvakgidrekgvtyaalvpnqrglenaleggineacvfmsasethnrkninkstses
    lhilkqvnndaqkanlttraylstvfgcpyekdvpieqvirlsealfefgiselslgdti
    gaanpaqvetvleallarfpanqialhfhdtrgtalanmvtalqmgitvfdgsagglggc
    pyapgssgnaatedivymleqmdiktnvklekllsaakwieekmgkplpsrnlqvfkssl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1ydoB (B:)
    mpypkkvtikevgprdglqnepvwiatedkitwinqlsrtglsyieitsfvhpkwipalr
    daidvakgidrekgvtyaalvpnqrglenaleggineacvfmsasethnrkninkstses
    lhilkqvnndaqkanlttraylstvfgcpyekdvpieqvirlsealfefgiselslgdti
    gaanpaqvetvleallarfpanqialhfhdtrgtalanmvtalqmgitvfdgsagglggc
    pyapgssgnaatedivymleqmdiktnvklekllsaakwieekmgkplpsrnlqvfks
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1ydoC (C:)
    mpypkkvtikevgprdglqnepvwiatedkitwinqlsrtglsyieitsfvhpkwipalr
    daidvakgidrekgvtyaalvpnqrglenaleggineacvfmsasethnrkninkstses
    lhilkqvnndaqkanlttraylstvfgcpyekdvpieqvirlsealfefgiselslgdti
    gaanpaqvetvleallarfpanqialhfhdtrgtalanmvtalqmgitvfdgsagglggc
    pyapgssgnaatedivymleqmdiktnvklekllsaakwieekmgkplpsrnlqvfkssl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1ydoC (C:)
    mpypkkvtikevgprdglqnepvwiatedkitwinqlsrtglsyieitsfvhpkwipalr
    daidvakgidrekgvtyaalvpnqrglenaleggineacvfmsasethnrkninkstses
    lhilkqvnndaqkanlttraylstvfgcpyekdvpieqvirlsealfefgiselslgdti
    gaanpaqvetvleallarfpanqialhfhdtrgtalanmvtalqmgitvfdgsagglggc
    pyapgssgnaatedivymleqmdiktnvklekllsaakwieekmgkplpsrnlqvfks
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1ydoD (D:)
    mpypkkvtikevgprdglqnepvwiatedkitwinqlsrtglsyieitsfvhpkwipalr
    daidvakgidrekgvtyaalvpnqrglenaleggineacvfmsasethnrkninkstses
    lhilkqvnndaqkanlttraylstvfgcpyekdvpieqvirlsealfefgiselslgdti
    gaanpaqvetvleallarfpanqialhfhdtrgtalanmvtalqmgitvfdgsagglggc
    pyapgssgnaatedivymleqmdiktnvklekllsaakwieekmgkplpsrnlqvfkssl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1ydoD (D:)
    mpypkkvtikevgprdglqnepvwiatedkitwinqlsrtglsyieitsfvhpkwipalr
    daidvakgidrekgvtyaalvpnqrglenaleggineacvfmsasethnrkninkstses
    lhilkqvnndaqkanlttraylstvfgcpyekdvpieqvirlsealfefgiselslgdti
    gaanpaqvetvleallarfpanqialhfhdtrgtalanmvtalqmgitvfdgsagglggc
    pyapgssgnaatedivymleqmdiktnvklekllsaakwieekmgkplpsrnlqvfks