PDB entry 1ydn

View 1ydn on RCSB PDB site
Description: crystal structure of the hmg-coa lyase from brucella melitensis, northeast structural genomics target lr35.
Deposited on 2004-12-24, released 2005-07-05
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydroxymethylglutaryl-CoA lyase
    Species: Brucella melitensis [TaxId:224914]
    Gene: GeneID:1197637
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YEF2
      • modified residue (9)
      • modified residue (63)
      • modified residue (81)
      • modified residue (188)
      • modified residue (255)
      • modified residue (259)
  • Chain 'B':
    Compound: hydroxymethylglutaryl-CoA lyase
    Species: Brucella melitensis [TaxId:224914]
    Gene: GeneID:1197637
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YEF2
      • modified residue (9)
      • modified residue (63)
      • modified residue (81)
      • modified residue (188)
      • modified residue (255)
      • modified residue (259)
  • Chain 'C':
    Compound: hydroxymethylglutaryl-CoA lyase
    Species: Brucella melitensis [TaxId:224914]
    Gene: GeneID:1197637
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YEF2
      • modified residue (9)
      • modified residue (63)
      • modified residue (81)
      • modified residue (188)
      • modified residue (255)
      • modified residue (259)
  • Chain 'D':
    Compound: hydroxymethylglutaryl-CoA lyase
    Species: Brucella melitensis [TaxId:224914]
    Gene: GeneID:1197637
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8YEF2
      • modified residue (9)
      • modified residue (63)
      • modified residue (81)
      • modified residue (188)
      • modified residue (255)
      • modified residue (259)
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ydnA (A:)
    maehveivemaardglqnekrfvptadkialinrlsdcgyarieatsfvspkwvpqlads
    revmagirradgvrysvlvpnmkgyeaaaaahadeiavfisasegfskaninctiaesie
    rlspvigaaindglairgyvscvvecpydgpvtpqavasvteqlfslgchevslgdtigr
    gtpdtvaamldavlaiapahslaghyhdtggraldnirvslekglrvfdasvgglggcpf
    apgakgnvdtvavvemlhemgfetgldldrlrsaglftqalrqdkaalehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1ydnA (A:)
    aehveivemaardglqnekrfvptadkialinrlsdcgyarieatsfvspkwvpqladsr
    evmagirradgvrysvlvpnmkgyeaaaaahadeiavfisasegfskaninctiaesier
    lspvigaaindglairgyvscvvecpydgpvtpqavasvteqlfslgchevslgdtigrg
    tpdtvaamldavlaiapahslaghyhdtggraldnirvslekglrvfdasvgglggcpfa
    pgakgnvdtvavvemlhemgfetgldldrlrsaglftqalrqd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1ydnB (B:)
    maehveivemaardglqnekrfvptadkialinrlsdcgyarieatsfvspkwvpqlads
    revmagirradgvrysvlvpnmkgyeaaaaahadeiavfisasegfskaninctiaesie
    rlspvigaaindglairgyvscvvecpydgpvtpqavasvteqlfslgchevslgdtigr
    gtpdtvaamldavlaiapahslaghyhdtggraldnirvslekglrvfdasvgglggcpf
    apgakgnvdtvavvemlhemgfetgldldrlrsaglftqalrqdkaalehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1ydnB (B:)
    aehveivemaardglqnekrfvptadkialinrlsdcgyarieatsfvspkwvpqladsr
    evmagirradgvrysvlvpnmkgyeaaaaahadeiavfisasegfskaninctiaesier
    lspvigaaindglairgyvscvvecpydgpvtpqavasvteqlfslgchevslgdtigrg
    tpdtvaamldavlaiapahslaghyhdtggraldnirvslekglrvfdasvgglggcpfa
    pgakgnvdtvavvemlhemgfetgldldrlrsaglftqalrqd
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1ydnC (C:)
    maehveivemaardglqnekrfvptadkialinrlsdcgyarieatsfvspkwvpqlads
    revmagirradgvrysvlvpnmkgyeaaaaahadeiavfisasegfskaninctiaesie
    rlspvigaaindglairgyvscvvecpydgpvtpqavasvteqlfslgchevslgdtigr
    gtpdtvaamldavlaiapahslaghyhdtggraldnirvslekglrvfdasvgglggcpf
    apgakgnvdtvavvemlhemgfetgldldrlrsaglftqalrqdkaalehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1ydnC (C:)
    aehveivemaardglqnekrfvptadkialinrlsdcgyarieatsfvspkwvpqladsr
    evmagirradgvrysvlvpnmkgyeaaaaahadeiavfisasegfskaninctiaesier
    lspvigaaindglairgyvscvvecpydgpvtpqavasvteqlfslgchevslgdtigrg
    tpdtvaamldavlaiapahslaghyhdtggraldnirvslekglrvfdasvgglggcpfa
    pgakgnvdtvavvemlhemgfetgldldrlrsaglftqalrqd
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1ydnD (D:)
    maehveivemaardglqnekrfvptadkialinrlsdcgyarieatsfvspkwvpqlads
    revmagirradgvrysvlvpnmkgyeaaaaahadeiavfisasegfskaninctiaesie
    rlspvigaaindglairgyvscvvecpydgpvtpqavasvteqlfslgchevslgdtigr
    gtpdtvaamldavlaiapahslaghyhdtggraldnirvslekglrvfdasvgglggcpf
    apgakgnvdtvavvemlhemgfetgldldrlrsaglftqalrqdkaalehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1ydnD (D:)
    aehveivemaardglqnekrfvptadkialinrlsdcgyarieatsfvspkwvpqladsr
    evmagirradgvrysvlvpnmkgyeaaaaahadeiavfisasegfskaninctiaesier
    lspvigaaindglairgyvscvvecpydgpvtpqavasvteqlfslgchevslgdtigrg
    tpdtvaamldavlaiapahslaghyhdtggraldnirvslekglrvfdasvgglggcpfa
    pgakgnvdtvavvemlhemgfetgldldrlrsaglftqalrqd