PDB entry 1ydm

View 1ydm on RCSB PDB site
Description: X-Ray structure of Northeast Structural Genomics target SR44
Deposited on 2004-12-24, released 2005-01-18
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yqgN
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yqgN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54491
      • modified residue (27)
      • modified residue (81)
      • modified residue (118)
  • Chain 'B':
    Compound: Hypothetical protein yqgN
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yqgN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54491
      • modified residue (27)
      • modified residue (81)
      • modified residue (118)
  • Chain 'C':
    Compound: Hypothetical protein yqgN
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yqgN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54491
      • modified residue (27)
      • modified residue (81)
      • modified residue (118)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ydmA (A:)
    mksqlrkktlealsalsnedilqktermykylfslpewqnagtiavtisrgleiptrpvi
    eqaweegkqvcipkchpdtkkmqfrtyqtddqletvyagllepviektkevnpsqidlmi
    vpgvcfdvngfrvgfgggyydrylseyegktvslllecqlfahvprlphdipvhklited
    riiscfs
    

    Sequence, based on observed residues (ATOM records):
    >1ydmA (A:)
    qlrkktlealsalsnedilqktermykylfslpewqnagtiavtisrgleiptrpvieqa
    weegkqvcipkctkkmqfrtyqtddqletvyagllepvktkevnpsqidlmivpgvcfdv
    ngfrvgfgggyydrylseyegktvslllecqlfahvprlphdipvhklitedriiscf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1ydmB (B:)
    mksqlrkktlealsalsnedilqktermykylfslpewqnagtiavtisrgleiptrpvi
    eqaweegkqvcipkchpdtkkmqfrtyqtddqletvyagllepviektkevnpsqidlmi
    vpgvcfdvngfrvgfgggyydrylseyegktvslllecqlfahvprlphdipvhklited
    riiscfs
    

    Sequence, based on observed residues (ATOM records):
    >1ydmB (B:)
    qlrkktlealsalsnedilqktermykylfslpewqnagtiavtisrgleiptrpvieqa
    weegkqvcipkchpdtkkmqfrtyqtddqletvyagllepviktkevnpsqidlmivpgv
    cfdvngfrvgfgggyydrylseyegktvslllecqlfahvprlphdipvhklitedriis
    cf
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1ydmC (C:)
    mksqlrkktlealsalsnedilqktermykylfslpewqnagtiavtisrgleiptrpvi
    eqaweegkqvcipkchpdtkkmqfrtyqtddqletvyagllepviektkevnpsqidlmi
    vpgvcfdvngfrvgfgggyydrylseyegktvslllecqlfahvprlphdipvhklited
    riiscfs
    

    Sequence, based on observed residues (ATOM records):
    >1ydmC (C:)
    qlrkktlealsalsnedilqktermykylfslpewqnagtiavtisrgleiptrpvieqa
    weegkqvcipkchpdtkkmqfrtyqtddqletvyagllepvektkevnpsqidlmivpgv
    cfdvngfrvgfgggyydrylseyegktvslllecqlfahvprlphdipvhklitedriis
    cf