PDB entry 1ydk

View 1ydk on RCSB PDB site
Description: Crystal structure of the I219A mutant of human glutathione transferase A1-1 with S-hexylglutathione
Class: transferase
Keywords: Glutathione transferase, S-hexylglutathione, TRANSFERASE
Deposited on 2004-12-24, released 2005-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ydka1, d1ydka2
  • Chain 'B':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263 (Start-221)
      • engineered (218)
    Domains in SCOPe 2.07: d1ydkb1, d1ydkb2
  • Heterogens: GTX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ydkA (A:)
    maekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleearkafrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydkA (A:)
    ekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveidg
    mklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdakla
    likekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpllk
    alktrisnlptvkkflqpgsprkppmd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ydkB (B:)
    maekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleearkafrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydkB (B:)
    kpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveidgm
    klvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdaklal
    ikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpllka
    lktrisnlptvkkflqpgsprkppmdeksleearkafrf