PDB entry 1ydi

View 1ydi on RCSB PDB site
Description: Human Vinculin Head Domain (VH1, 1-258) in Complex with Human Alpha-Actinin's Vinculin-Binding Site (Residues 731-760)
Class: Cell Adhesion, Structural Protein
Keywords: Cell Adhesion, Structural Protein
Deposited on 2004-12-23, released 2005-07-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vinculin isoform VCL
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18206-2 (5-262)
      • expression tag (0-4)
    Domains in SCOPe 2.06: d1ydia1, d1ydia2, d1ydia3
  • Chain 'B':
    Compound: Alpha-actinin 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ACTN4
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ydiA (A:)
    hhhhhmpvfhtrtiesilepvaqqishlvimheegevdgkaipdltapvaavqaavsnlv
    rvgketvqttedqilkrdmppafikvenactklvqaaqmlqsdpysvpardylidgsrgi
    lsgtsdllltfdeaevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmi
    derqqelthqehrvmlvnsmntvkellpvlisamkifvttknsknqgieealknrnftve
    kmsaeineiirvlqltswdedaw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydiA (A:)
    hhhhhmpvfhtrtiesilepvaqqishlvimheaipdltapvaavqaavsnlvrvgketv
    qttedqilkrdmppafikvenactklvqaaqmlqsdpysvpardylidgsrgilsgtsdl
    lltfdeaevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderqqel
    thqehrvmlvnsmntvkellpvlisamkifvttknsknqgieealknrnftvekmsaein
    eiirvlqltswdedaw
    

  • Chain 'B':
    No sequence available.