PDB entry 1ydh

View 1ydh on RCSB PDB site
Description: X-ray structure of a lysine decarboxylase-like protein from arabidopsis thaliana gene at5g11950
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, PSI, Center for Eukaryotic Structural Genomics, CESG, AT5G11950, LYSINE DECARBOXYLASE-LIKE PROTEIN, UNKNOWN FUNCTION
Deposited on 2004-12-23, released 2005-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: At5g11950
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT5G11950
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84MC2
      • modified residue (53)
      • modified residue (76)
      • modified residue (94)
      • modified residue (101)
      • modified residue (118)
      • modified residue (124)
      • modified residue (180)
      • modified residue (183)
    Domains in SCOPe 2.07: d1ydha_
  • Chain 'B':
    Compound: At5g11950
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AT5G11950
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84MC2
      • modified residue (53)
      • modified residue (76)
      • modified residue (94)
      • modified residue (101)
      • modified residue (118)
      • modified residue (124)
      • modified residue (180)
      • modified residue (183)
    Domains in SCOPe 2.07: d1ydhb_
  • Heterogens: NO3, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ydhA (A:)
    sednqrsrfrkicvfcgshsghrevfsdaaielgnelvkrkidlvygggsvglmglisrr
    vyegglhvlgiipkalmpieisgetvgdvrvvadmherkaamaqeaeafialpggygtme
    ellemitwsqlgihkktvgllnvdgyynnllalfdtgveegfikpgarnivvsaptakel
    mekmeeytpshmhvasheswkveelgdypgqenkpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydhA (A:)
    qrsrfrkicvfcgshsghrevfsdaaielgnelvkrkidlvygggsvglmglisrrvyeg
    glhvlgiipkalmpieisgetvgdvrvvadmherkaamaqeaeafialpggygtmeelle
    mitwsqlgihkktvgllnvdgyynnllalfdtgveegfikpgarnivvsaptakelmekm
    eeyt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ydhB (B:)
    sednqrsrfrkicvfcgshsghrevfsdaaielgnelvkrkidlvygggsvglmglisrr
    vyegglhvlgiipkalmpieisgetvgdvrvvadmherkaamaqeaeafialpggygtme
    ellemitwsqlgihkktvgllnvdgyynnllalfdtgveegfikpgarnivvsaptakel
    mekmeeytpshmhvasheswkveelgdypgqenkpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydhB (B:)
    rfrkicvfcgshsghrevfsdaaielgnelvkrkidlvygggsvglmglisrrvyegglh
    vlgiipkalmpieisgetvgdvrvvadmherkaamaqeaeafialpggygtmeellemit
    wsqlgihkktvgllnvdgyynnllalfdtgveegfikpgarnivvsaptakelmekmeey
    t