PDB entry 1ydg

View 1ydg on RCSB PDB site
Description: Crystal Structure of Trp repressor binding protein WrbA
Class: protein binding
Keywords: tetramer, Structural Genomics, PSI, Protein Structure Initiative, New York Structural GenomiX Research Consortium, NYSGXRC
Deposited on 2004-12-23, released 2005-01-04
The last revision prior to the SCOP 1.75 freeze date was dated 2006-02-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trp repressor binding protein WrbA
    Species: Deinococcus radiodurans
    Gene: DRA0214
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYU4 (Start-202)
      • cloning artifact (201)
      • cloning artifact (203-204)
    Domains in SCOP 1.75: d1ydga_
  • Chain 'B':
    Compound: Trp repressor binding protein WrbA
    Species: Deinococcus radiodurans
    Gene: DRA0214
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYU4 (3-202)
      • cloning artifact (201)
      • cloning artifact (203-204)
    Domains in SCOP 1.75: d1ydgb_
  • Chain 'C':
    Compound: Trp repressor binding protein WrbA
    Species: Deinococcus radiodurans
    Gene: DRA0214
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYU4 (3-202)
      • cloning artifact (201)
      • cloning artifact (203-204)
    Domains in SCOP 1.75: d1ydgc_
  • Chain 'D':
    Compound: Trp repressor binding protein WrbA
    Species: Deinococcus radiodurans
    Gene: DRA0214
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYU4 (3-202)
      • cloning artifact (201)
      • cloning artifact (203-204)
    Domains in SCOP 1.75: d1ydgd_
  • Chain 'E':
    Compound: Trp repressor binding protein WrbA
    Species: Deinococcus radiodurans
    Gene: DRA0214
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYU4 (3-202)
      • cloning artifact (1-2)
      • cloning artifact (201)
      • cloning artifact (203-204)
    Domains in SCOP 1.75: d1ydge_
  • Chain 'F':
    Compound: Trp repressor binding protein WrbA
    Species: Deinococcus radiodurans
    Gene: DRA0214
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYU4 (Start-202)
      • cloning artifact (201)
      • cloning artifact (203-204)
    Domains in SCOP 1.75: d1ydgf_
  • Chain 'G':
    Compound: Trp repressor binding protein WrbA
    Species: Deinococcus radiodurans
    Gene: DRA0214
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYU4 (3-202)
      • cloning artifact (201)
      • cloning artifact (203-204)
    Domains in SCOP 1.75: d1ydgg_
  • Chain 'H':
    Compound: Trp repressor binding protein WrbA
    Species: Deinococcus radiodurans
    Gene: DRA0214
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYU4 (3-202)
      • cloning artifact (201)
      • cloning artifact (203-204)
    Domains in SCOP 1.75: d1ydgh_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ydgA (A:)
    msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawka
    nieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsa
    mtsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqplle
    ndrasirhqvrrqveltaklleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydgA (A:)
    apvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkaniea
    mkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsa
    qnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendra
    sirhqvrrqveltaklleggs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ydgB (B:)
    msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawka
    nieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsa
    mtsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqplle
    ndrasirhqvrrqveltaklleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydgB (B:)
    tapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanie
    amkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamts
    aqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendr
    asirhqvrrqveltaklleggs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ydgC (C:)
    msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawka
    nieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsa
    mtsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqplle
    ndrasirhqvrrqveltaklleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydgC (C:)
    tapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanie
    amkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamts
    aqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendr
    asirhqvrrqveltaklleggs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ydgD (D:)
    msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawka
    nieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsa
    mtsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqplle
    ndrasirhqvrrqveltaklleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydgD (D:)
    tapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanie
    amkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamts
    aqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendr
    asirhqvrrqveltaklleggs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ydgE (E:)
    msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawka
    nieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsa
    mtsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqplle
    ndrasirhqvrrqveltaklleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydgE (E:)
    sltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkan
    ieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsam
    tsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllen
    drasirhqvrrqveltaklleggs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ydgF (F:)
    msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawka
    nieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsa
    mtsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqplle
    ndrasirhqvrrqveltaklleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydgF (F:)
    apvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkaniea
    mkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamtsa
    qnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendra
    sirhqvrrqveltaklleggs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ydgG (G:)
    msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawka
    nieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsa
    mtsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqplle
    ndrasirhqvrrqveltaklleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydgG (G:)
    tapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanie
    amkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamts
    aqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendr
    asirhqvrrqveltaklleggs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ydgH (H:)
    msltapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawka
    nieamkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsa
    mtsaqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqplle
    ndrasirhqvrrqveltaklleggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydgH (H:)
    tapvklaivfysstgtgyamaqeaaeagraagaevrllkvretapqdvidgqdawkanie
    amkdvpeatpadlewaeaivfssptrfggatsqmrafidtlgglwssgklanktfsamts
    aqnvnggqettlqtlymtamhwgavltppgytdevifksggnpygasvtangqpllendr
    asirhqvrrqveltaklleggs