PDB entry 1ydf

View 1ydf on RCSB PDB site
Description: Crystal structure of a HAD-like phosphatase from Streptococcus pneumoniae
Class: structural genomics, unknown function
Keywords: Structural genomics, Protein structure initiative, Hypothetical protein, NYSGXRC, hydrolase haloacid dehalogenase-like family, PSI, New York SGX Research Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-12-23, released 2005-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.217
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydrolase, haloacid dehalogenase-like family
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97Q24 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d1ydfa1, d1ydfa2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ydfA (A:)
    slykgylidldgtiykgkdripagetfvhelqkrdipylfvtnnttrtpesvkemlaqnf
    nidtplstvytatlatidymndlglektvyvvgeaglkeaikaagyvedkekpayvvvgl
    dwqvdyekfatatlaiqkgahfigtnpdlniptergllpgagslitllevatrvkpvyig
    kpnaiimdkavehlglereelimvgdnyltdiragidngiptllvttgftkaeevaglpi
    apthvvsslaewdfden
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydfA (A:)
    slykgylidldgtiykgkdripagetfvhelqkrdipylfvtnnttrtpesvkemlaqnf
    nidtplstvytatlatidymndlglektvyvvgeaglkeaikaagyvedkekpayvvvgl
    dwqvdyekfatatlaiqkgahfigtnpdlniptergllpgagslitllevatrvkpvyig
    kpnaiimdkavehlglereelimvgdnyltdiragidngiptllvttgftkaeevaglpi
    apthvvsslaewdfd