PDB entry 1yde

View 1yde on RCSB PDB site
Description: Crystal Structure of Human Retinal Short-Chain Dehydrogenase/Reductase 3
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2004-12-23, released 2005-01-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-03-14, with a file datestamp of 2012-03-09.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.182
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinal dehydrogenase/reductase 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ydea1
  • Chain 'B':
    Compound: Retinal dehydrogenase/reductase 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ydeb_
  • Chain 'C':
    Compound: Retinal dehydrogenase/reductase 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ydec_
  • Chain 'D':
    Compound: Retinal dehydrogenase/reductase 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1yded_
  • Chain 'E':
    Compound: Retinal dehydrogenase/reductase 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ydee_
  • Chain 'F':
    Compound: Retinal dehydrogenase/reductase 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ydef_
  • Chain 'G':
    Compound: Retinal dehydrogenase/reductase 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ydeg_
  • Chain 'H':
    Compound: Retinal dehydrogenase/reductase 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ydeh_
  • Chain 'I':
    Compound: Retinal dehydrogenase/reductase 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ydei_
  • Chain 'J':
    Compound: Retinal dehydrogenase/reductase 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ydej_
  • Chain 'K':
    Compound: Retinal dehydrogenase/reductase 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ydek_
  • Chain 'L':
    Compound: Retinal dehydrogenase/reductase 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ydel_
  • Chain 'M':
    Compound: Retinal dehydrogenase/reductase 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ydem_
  • Chain 'N':
    Compound: Retinal dehydrogenase/reductase 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1yden_
  • Chain 'O':
    Compound: Retinal dehydrogenase/reductase 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ydeo_
  • Chain 'P':
    Compound: Retinal dehydrogenase/reductase 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1ydep_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ydeA (A:)
    matgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfil
    cdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtyt
    ltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvn
    cispgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctg
    iellvtggaelgygckasrstpvdapdips
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydeA (A:)
    gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
    tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
    lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
    pgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiel
    lvtggaelgy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ydeB (B:)
    matgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfil
    cdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtyt
    ltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvn
    cispgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctg
    iellvtggaelgygckasrstpvdapdips
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydeB (B:)
    tgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcd
    vtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytlt
    klalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvnci
    spgniwtplweprasiregmlaqplgrmgqpaevgaaavflaseanfctgiellvtggae
    lgygcka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ydeC (C:)
    matgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfil
    cdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtyt
    ltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvn
    cispgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctg
    iellvtggaelgygckasrstpvdapdips
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydeC (C:)
    gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
    tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
    lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
    pgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiel
    lvtggaelgy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ydeD (D:)
    matgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfil
    cdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtyt
    ltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvn
    cispgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctg
    iellvtggaelgygckasrstpvdapdips
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydeD (D:)
    gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
    tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
    lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
    pgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiel
    lvtggaelgygckas
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ydeE (E:)
    matgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfil
    cdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtyt
    ltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvn
    cispgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctg
    iellvtggaelgygckasrstpvdapdips
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydeE (E:)
    gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
    tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
    lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
    pgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiel
    lvtggaelgy
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ydeF (F:)
    matgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfil
    cdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtyt
    ltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvn
    cispgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctg
    iellvtggaelgygckasrstpvdapdips
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydeF (F:)
    gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
    tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
    lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
    pgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiel
    lvtggaelgygckasr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ydeG (G:)
    matgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfil
    cdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtyt
    ltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvn
    cispgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctg
    iellvtggaelgygckasrstpvdapdips
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydeG (G:)
    ryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdvtq
    eddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltkla
    lpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncispg
    niwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiellv
    tggaelg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ydeH (H:)
    matgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfil
    cdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtyt
    ltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvn
    cispgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctg
    iellvtggaelgygckasrstpvdapdips
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydeH (H:)
    tryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdvt
    qeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltkl
    alpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncisp
    gniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiell
    vtggaelgygckas
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1ydeI (I:)
    matgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfil
    cdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtyt
    ltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvn
    cispgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctg
    iellvtggaelgygckasrstpvdapdips
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydeI (I:)
    yagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdvtqe
    ddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltklal
    pylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncispgn
    iwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiellvt
    ggaelgy
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1ydeJ (J:)
    matgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfil
    cdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtyt
    ltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvn
    cispgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctg
    iellvtggaelgygckasrstpvdapdips
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydeJ (J:)
    gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
    tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
    lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
    pgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiel
    lvtggaelgygckas
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1ydeK (K:)
    matgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfil
    cdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtyt
    ltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvn
    cispgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctg
    iellvtggaelgygckasrstpvdapdips
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydeK (K:)
    gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
    tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
    lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
    pgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiel
    lvtggaelgy
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1ydeL (L:)
    matgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfil
    cdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtyt
    ltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvn
    cispgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctg
    iellvtggaelgygckasrstpvdapdips
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydeL (L:)
    gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
    tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
    lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
    pgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiel
    lvtggaelgygckas
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1ydeM (M:)
    matgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfil
    cdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtyt
    ltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvn
    cispgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctg
    iellvtggaelgygckasrstpvdapdips
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydeM (M:)
    kvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdvtqeddv
    ktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltklalpyl
    rksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncispgniwt
    plweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiellvtgga
    elgy
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1ydeN (N:)
    matgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfil
    cdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtyt
    ltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvn
    cispgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctg
    iellvtggaelgygckasrstpvdapdips
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydeN (N:)
    kvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdvtqeddv
    ktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltklalpyl
    rksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncispgniwt
    plweprasiregmlaqplgrmgqpaevgaaavflaseanfctgiellvtggaelgygcka
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1ydeO (O:)
    matgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfil
    cdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtyt
    ltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvn
    cispgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctg
    iellvtggaelgygckasrstpvdapdips
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydeO (O:)
    yagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdvtqe
    ddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltklal
    pylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncispgn
    iwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiellvt
    ggaelgy
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1ydeP (P:)
    matgtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfil
    cdvtqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtyt
    ltklalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvn
    cispgniwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctg
    iellvtggaelgygckasrstpvdapdips
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydeP (P:)
    ryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdvtq
    eddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltkla
    lpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncispg
    niwtplweelaalmpdprasiregmlaqplgrmgqpaevgaaavflaseanfctgiellv
    tggaelgygckasr