PDB entry 1yd7

View 1yd7 on RCSB PDB site
Description: conserved hypothetical protein pfu-1647980-001 from pyrococcus furiosus
Deposited on 2004-12-23, released 2005-02-08
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-keto acid:ferredoxin oxidoreductase subunit alpha
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U046
      • modified residue (55)
      • modified residue (59)
      • modified residue (69)
      • modified residue (90)
      • modified residue (101)
      • modified residue (110)
      • modified residue (191)
  • Heterogens: UNX, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yd7A (A:)
    ahhhhhhgsnkrfpfpvgepdfiqgdeaiaraailagcrfyagypitpaseifeamalym
    plvdgvviqmedeiasiaaaigaswagakamtatsgpgfslmqenigyavmtetpvvivd
    vqrsgpstgqptlpaqgdimqaiwgthgdhslivlspstvqeafdftirafnlsekyrtp
    villtdaevghmrervyipnpdeieiinrklprneeeaklpfgdphgdgvppmpifgkgy
    rtyvtglthdekgrprtvdrevherlikrivekieknkkdiftyetyeledaeigvvatg
    ivarsalravkmlreegikagllkietiwpfdfelieriaervdklyvpemnlgqlyhli
    kegangkaevkliskiggevhtpmeifefirrefk
    

    Sequence, based on observed residues (ATOM records):
    >1yd7A (A:)
    rfpfpvgepdfiqgdeaiaraailagcrfyagypitpaseifeamalymplvdgvviqme
    deiasiaaaigaswagakamtatsgpgfslmqenimtetpvvivdvqdhslivlspstvq
    eafdftirafnlsekyrtpvilltdaevghmrervyipnpdeieiinrk