PDB entry 1yd6

View 1yd6 on RCSB PDB site
Description: Crystal structure of the GIY-YIG N-terminal endonuclease domain of UvrC from Bacillus caldotenax
Deposited on 2004-12-23, released 2005-03-01
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UvrC
    Species: Bacillus caldotenax [TaxId:1395]
    Database cross-references and differences (RAF-indexed):
    • PDB 1YD6 (0-End)
  • Chain 'B':
    Compound: UvrC
    Species: Bacillus caldotenax [TaxId:1395]
    Database cross-references and differences (RAF-indexed):
    • PDB 1YD6
  • Chain 'C':
    Compound: UvrC
    Species: Bacillus caldotenax [TaxId:1395]
    Database cross-references and differences (RAF-indexed):
    • PDB 1YD6 (0-End)
  • Chain 'D':
    Compound: UvrC
    Species: Bacillus caldotenax [TaxId:1395]
    Database cross-references and differences (RAF-indexed):
    • PDB 1YD6
  • Heterogens: CL, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yd6A (A:)
    mnerlkeklavlpeqpgcylmkdkhgtviyvgkakslkervrsyftgthdgktqrlveei
    adfeyivtssnaealilemnlikkhdpkynvmlkddksy
    

    Sequence, based on observed residues (ATOM records):
    >1yd6A (A:)
    mnerlkeklavlpeqpgcylmkdkhgtviyvgkakslkervrsyftgthdgktqrlveei
    adfeyivtssnaealilemnlikkhdpkynvmlkd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1yd6B (B:)
    mnerlkeklavlpeqpgcylmkdkhgtviyvgkakslkervrsyftgthdgktqrlveei
    adfeyivtssnaealilemnlikkhdpkynvmlkddksy
    

    Sequence, based on observed residues (ATOM records):
    >1yd6B (B:)
    klavlpeqpgcylmkdkhgtviyvgkakslkervrsyftgthdgktqrlveeiadfeyiv
    tssnaealilemnlikkhdpkynvmlkd
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1yd6C (C:)
    mnerlkeklavlpeqpgcylmkdkhgtviyvgkakslkervrsyftgthdgktqrlveei
    adfeyivtssnaealilemnlikkhdpkynvmlkddksy
    

    Sequence, based on observed residues (ATOM records):
    >1yd6C (C:)
    mnerlkeklavlpeqpgcylmkdkhgtviyvgkakslkervrsyftgthdgktqrlveei
    adfeyivtssnaealilemnlikkhdpkynvmlk
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1yd6D (D:)
    mnerlkeklavlpeqpgcylmkdkhgtviyvgkakslkervrsyftgthdgktqrlveei
    adfeyivtssnaealilemnlikkhdpkynvmlkddksy
    

    Sequence, based on observed residues (ATOM records):
    >1yd6D (D:)
    nerlkeklavlpeqpgcylmkdkhgtviyvgkakslkervrsyftgthdgktqrlveeia
    dfeyivtssnaealilemnlikkhdpkynvmlkddk