PDB entry 1yd4

View 1yd4 on RCSB PDB site
Description: Crystal structure of the GIY-YIG N-terminal endonuclease domain of UvrC from Thermotoga maritima: Point mutant Y29F bound to its catalytic divalent cation
Deposited on 2004-12-23, released 2005-03-01
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.172
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UvrABC system protein C
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYA3 (0-End)
      • engineered (28)
  • Heterogens: MN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yd4A (A:)
    mkekirkkillapeepgvyifknkgvpifigkakrlsnrlrsylnpqtekvfrigeeade
    letivvmnereafileanlikkyrpkynvrlkdtdf
    

    Sequence, based on observed residues (ATOM records):
    >1yd4A (A:)
    mkekirkkillapeepgvyifknkgvpifigkakrlsnrlrsylnpqtekvfrigeeade
    letivvmnereafileanlikkyrpkynv