PDB entry 1ycy

View 1ycy on RCSB PDB site
Description: Conserved hypothetical protein Pfu-1806301-001 from Pyrococcus furiosus
Class: structural genomics, unknown function
Keywords: Structural Genomics, Southeast Collaboratory for Structural Genomics, SECSG, Protein Structure Initiative, PSI, conserved hypothetical protein, Pyrococcus furiosus, hyperthermophile, unknown function
Deposited on 2004-12-23, released 2005-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TZN2
      • modified residue (56)
      • modified residue (67)
    Domains in SCOPe 2.07: d1ycya1
  • Chain 'B':
    Compound: conserved hypothetical protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TZN2
      • modified residue (56)
      • modified residue (67)
    Domains in SCOPe 2.07: d1ycyb_
  • Chain 'C':
    Compound: conserved hypothetical protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TZN2
      • modified residue (56)
      • modified residue (67)
    Domains in SCOPe 2.07: d1ycyc_
  • Chain 'D':
    Compound: conserved hypothetical protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TZN2
      • modified residue (56)
      • modified residue (67)
    Domains in SCOPe 2.07: d1ycyd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ycyA (A:)
    mgmesllekvlkewkghkvavsvggdhsftgtledfdeevillkdvvdvignrgkqmlig
    ledinwimlle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ycyA (A:)
    sllekvlkewkghkvavsvgftgtledfdeevillkdvvdvignrgkqmligledinwim
    ll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ycyB (B:)
    mgmesllekvlkewkghkvavsvggdhsftgtledfdeevillkdvvdvignrgkqmlig
    ledinwimlle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ycyB (B:)
    sllekvlkewkghkvavsvgftgtledfdeevillkdvvdvignrgkqmligledinwim
    ll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ycyC (C:)
    mgmesllekvlkewkghkvavsvggdhsftgtledfdeevillkdvvdvignrgkqmlig
    ledinwimlle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ycyC (C:)
    sllekvlkewkghkvavsvgftgtledfdeevillkdvvdvignrgkqmligledinwim
    ll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ycyD (D:)
    mgmesllekvlkewkghkvavsvggdhsftgtledfdeevillkdvvdvignrgkqmlig
    ledinwimlle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ycyD (D:)
    sllekvlkewkghkvavsvgftgtledfdeevillkdvvdvignrgkqmligledinwim
    ll