PDB entry 1ycs

View 1ycs on RCSB PDB site
Description: p53-53bp2 complex
Deposited on 1996-09-30, released 1997-11-19
The last revision prior to the SCOP 1.57 freeze date was dated 1997-11-19, with a file datestamp of 1997-11-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ycsA (A:)
    vpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgtr
    vramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsv
    vvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvca
    cpgrdrrteee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ycsB (B:)
    plallldsslegefdlvqriiyevddpslpndegitalhnavcaghteivkflvqfgvnv
    naadsdgwtplhcaascnnvqvckflvesgaavfamtysdmqtaadkceemeegytqcsq
    flygvqekmgimnkgviyalwdyepqnddelpmkegdcmtiihrededeiewwwarlndk
    egyvprnllglyp