PDB entry 1ycr
View 1ycr on RCSB PDB site
Description: mdm2 bound to the transactivation domain of p53
Class: complex (oncogene protein/peptide)
Keywords: anti-oncogene, DNA-binding, transcription regulation, nuclear protein, complex (oncogene protein/peptide), phosphorylation, activator
Deposited on
1996-09-30, released
1997-11-19
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2
AEROSPACI score: 0.3
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: mdm2
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1ycra_ - Chain 'B':
Compound: p53
Database cross-references and differences (RAF-indexed):
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1ycrA (A:)
sqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy
csndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgtsvsen
Sequence, based on observed residues (ATOM records): (download)
>1ycrA (A:)
etlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
lfgvpsfsvkehrkiytmiyrnlvv
- Chain 'B':
No sequence available.