PDB entry 1ycr

View 1ycr on RCSB PDB site
Description: mdm2 bound to the transactivation domain of p53
Class: complex (oncogene protein/peptide)
Keywords: anti-oncogene, DNA-binding, transcription regulation, nuclear protein, complex (oncogene protein/peptide), phosphorylation, activator
Deposited on 1996-09-30, released 1997-11-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mdm2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ycra_
  • Chain 'B':
    Compound: p53
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ycrA (A:)
sqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy
csndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgtsvsen

    Sequence, based on observed residues (ATOM records): (download) 
    >1ycrA (A:)
etlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
lfgvpsfsvkehrkiytmiyrnlvv

  • Chain 'B':
    No sequence available.