PDB entry 1ycr

View 1ycr on RCSB PDB site
Description: mdm2 bound to the transactivation domain of p53
Class: complex (oncogene protein/peptide)
Keywords: ANTI-ONCOGENE, DNA-BINDING, TRANSCRIPTION REGULATION, NUCLEAR PROTEIN, COMPLEX (ONCOGENE PROTEIN-PEPTIDE), PHOSPHORYLATION, ACTIVATOR, COMPLEX (ONCOGENE PROTEIN-PEPTIDE) complex
Deposited on 1996-09-30, released 1997-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mdm2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ycra_
  • Chain 'B':
    Compound: p53
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ycrA (A:)
    sqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy
    csndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgtsvsen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ycrA (A:)
    etlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
    lfgvpsfsvkehrkiytmiyrnlvv
    

  • Chain 'B':
    No sequence available.