PDB entry 1ycq
View 1ycq on RCSB PDB site
Description: xenopus laevis mdm2 bound to the transactivation domain of human p53
Class: complex (oncogene protein/peptide)
Keywords: anti-oncogene, DNA-binding, transcription regulation, nuclear protein, complex (oncogene protein/peptide), phosphorylation, activator
Deposited on
1996-09-30, released
1997-11-19
The last revision prior to the SCOP 1.73 freeze date was dated
1997-11-19, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.188
AEROSPACI score: 0.37
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: mdm2
Species: Xenopus laevis
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d1ycqa_ - Chain 'B':
Compound: p53
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1ycqA (A:)
nhistsdqeklvqptplllsllksagaqketftmkeviyhlgqyimakqlydekqqhivh
csndplgelfgvqefsvkeprrlyamisrnlvsanvkessedifgnv
Sequence, based on observed residues (ATOM records): (download)
>1ycqA (A:)
eklvqptplllsllksagaqketftmkeviyhlgqyimakqlydekqqhivhcsndplge
lfgvqefsvkeprrlyamisrnlvsanv
- Chain 'B':
No sequence available.