PDB entry 1ycp

View 1ycp on RCSB PDB site
Description: the crystal structure of fibrinogen-aa peptide 1-23 (f8y) bound to bovine thrombin explains why the mutation of phe-8 to tyrosine strongly inhibits normal cleavage at arginine-16
Class: hydrolase/hydrolase substrate
Keywords: fibrinopeptide-a, complex (serine protease-peptide), thrombin, hydrolase-hydrolase substrate complex
Deposited on 1997-05-01, released 1998-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.183
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: fibrinopeptide a-alpha
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: alpha thrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ycp.1
  • Chain 'J':
    Compound: epsilon thrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ycp.2
  • Chain 'K':
    Compound: epsilon thrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ycp.2
  • Chain 'L':
    Compound: epsilon thrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ycp.1
  • Chain 'M':
    Compound: epsilon thrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ycp.2
  • Chain 'N':
    Compound: fibrinopeptide a-alpha
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'F':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ycpH (H:)
    ivegqdaevglspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddll
    vrigkhsrtryerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvcl
    pdkqtaakllhagfkgrvtgwgnrretwttsvaevqpsvlqvvnlplverpvckastrir
    itdnmfcagykpgegkrgdacegdsggpfvmkspynnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidrlgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ycpH (H:)
    ivegqdaevglspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddll
    vrigkhsrtryerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvcl
    pdkqtaakllhagfkgrvtgwgnrrevqpsvlqvvnlplverpvckastriritdnmfca
    gykpgegkrgdacegdsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkk
    wiqkvid
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1ycpJ (J:)
    tsedhfqpffnektfgageadcglrplfekkqvqdqtekelfesyiegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ycpJ (J:)
    adcglrplfekkqvqdqtekelfesyieg
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1ycpK (K:)
    ivegqdaevglspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddll
    vrigkhsrtryerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvcl
    pdkqtaakllhagfkgrvtgwgnrretwtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ycpK (K:)
    ivegqdaevglspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddll
    vrigkhsrtryerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvcl
    pdkqtaakllhagfkgrvtgwgnrre
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1ycpL (L:)
    tsedhfqpffnektfgageadcglrplfekkqvqdqtekelfesyiegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ycpL (L:)
    adcglrplfekkqvqdqtekelfesyieg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1ycpM (M:)
    svaevqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdacegdsggpfv
    mkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidrlgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ycpM (M:)
    vqpsvlqvvnlplverpvckastriritdnmfcagykpgegkrgdacegdsggpfvmksp
    ynnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvid
    

  • Chain 'N':
    No sequence available.