PDB entry 1yco

View 1yco on RCSB PDB site
Description: crystal structure of a branched-chain phosphotransacylase from enterococcus faecalis v583
Deposited on 2004-12-22, released 2005-01-18
The last revision was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.232
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: branched-chain phosphotransacylase
    Species: Enterococcus faecalis [TaxId:226185]
    Gene: ptb
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q834I9 (0-272)
      • expression tag (273-275)
  • Chain 'B':
    Compound: branched-chain phosphotransacylase
    Species: Enterococcus faecalis [TaxId:226185]
    Gene: ptb
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q834I9 (0-272)
      • expression tag (273)
  • Heterogens: PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ycoA (A:)
    mitvsiaggsqpeilqlvkkalkeaeqplqfivfdtnenldtenlwkyvhcsdeaavaqe
    avslvatgqaqillkgiiqthtllkemlksehqlknkpilshvamvelpagktflltdca
    mniaptqatlieivenakevaqklglhhpkiallsaaenfnpkmpssvlakevtahfndq
    qeatvfgplsldlatseeavahkrysgpimgdadilvvptidvgnclyksltlfghakvg
    gtivgtkvpvvltsrsdsteskfhslrfamrqvhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1ycoA (A:)
    mitvsiaggsqpeilqlvkkalkeaeqplqfivfdtnenldtenlwkyvhcsdeaavaqe
    avslvatgqaqillkgiiqthtllkemlksehqlknkpilshvamvelpagktflltdca
    mniaptqatlieivenakevaqklglhhpkiallsaaenfnpkmpssvlakevtahfndq
    qeatvfgplsldlatseeavahkrysgpimgdadilvvptidvgnclyksltlfghakvg
    gtivgtkvpvvltsrsdsteskfhslrfamrqvhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1ycoB (B:)
    mitvsiaggsqpeilqlvkkalkeaeqplqfivfdtnenldtenlwkyvhcsdeaavaqe
    avslvatgqaqillkgiiqthtllkemlksehqlknkpilshvamvelpagktflltdca
    mniaptqatlieivenakevaqklglhhpkiallsaaenfnpkmpssvlakevtahfndq
    qeatvfgplsldlatseeavahkrysgpimgdadilvvptidvgnclyksltlfghakvg
    gtivgtkvpvvltsrsdsteskfhslrfamrqvhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1ycoB (B:)
    mitvsiaggsqpeilqlvkkalkeaeqplqfivfdtnenldtenlwkyvhcsdeaavaqe
    avslvatgqaqillkgiiqthtllkemlksepilshvamvelpagktflltdcamniapt
    qatlieivenakevaqklglhhpkiallsaanfnpkmpssvlakevtahfndqqeatvfg
    plsldlatseeavahkrysgpimgdadilvvptidvgnclyksltlfghakvggtivgtk
    vpvvltsrsdsteskfhslrfamrqvh