PDB entry 1ycm

View 1ycm on RCSB PDB site
Description: Solution Structure of matrix metalloproteinase 12 (MMP12) in the presence of N-Isobutyl-N-[4-methoxyphenylsulfonyl]glycyl hydroxamic acid (NNGH)
Class: hydrolase
Keywords: macrophage metalloelastase, MMP-12, solution structure, NNGH, zinc, calcium, Structural Proteomics in Europe, SPINE, Structural Genomics, HYDROLASE
Deposited on 2004-12-22, released 2005-04-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Macrophage metalloelastase
  Species: Homo sapiens [TaxId:9606]
  Gene: MMP12, HME
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39900 (1-158)
    • initiating methionine (0)
    • engineered (66)
  Domains in SCOPe 2.03: d1ycma1
• Heterogens: ZN, CA, NGH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ycmA (A:)
  mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
  rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
  glghssdpkavmfptykyvdintfrlsaddirgiqslyg