PDB entry 1ycl

View 1ycl on RCSB PDB site
Description: Crystal Structure of B. subtilis LuxS in Complex with a Catalytic 2-Ketone Intermediate
Class: hydrolase
Keywords: Quorum Sensing, metalloenzyme, HYDROLASE
Deposited on 2004-12-22, released 2005-03-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.225
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-ribosylhomocysteinase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: luxS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34667 (Start-155)
      • engineered (82)
    Domains in SCOPe 2.06: d1ycla_
  • Heterogens: CO, SO4, KRI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1yclA (A:)
psvesfeldhnavvapyvrhcgvhkvgtdgvvnkfdirfcqpnkqamkpdtihtlehlla
ftirshaekydhfdiidispmgaqtgyylvvsgeptsaeivdlledtmkeaveiteipaa
nekqcgqaklhdlegakrlmrfwlsqdkeellkvfg

    Sequence, based on observed residues (ATOM records): (download) 
    >1yclA (A:)
vesfeldhnavvapyvrhcgvhkvgtdgvvnkfdirfcqpnkqamkpdtihtlehllaft
irshaekydhfdiidispmgaqtgyylvvsgeptsaeivdlledtmkeaveiteipaane
kqcgqaklhdlegakrlmrfwlsqdkeellkvfg