PDB entry 1yck

View 1yck on RCSB PDB site
Description: Crystal structure of human peptidoglycan recognition protein (PGRP-S)
Class: immune system
Keywords: crystal structure, PGRP-S, peptidoglycan recognition, innate immunity, pattern recognition proteins, IMMUNE SYSTEM
Deposited on 2004-12-22, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.183
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidoglycan recognition protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ycka1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yckA (A:)
    qetedpaccspivprnewkalasecaqhlslplryvvvshtagsscntpascqqqarnvq
    hyhmktlgwcdvgynfligedglvyegrgwnftgahsghlwnpmsigisfmgnymdrvpt
    pqairaaqgllacgvaqgalrsnyvlkghrdvqrtlspgnqlyhliqnwphyrsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yckA (A:)
    cspivprnewkalasecaqhlslplryvvvshtagsscntpascqqqarnvqhyhmktlg
    wcdvgynfligedglvyegrgwnftgahsghlwnpmsigisfmgnymdrvptpqairaaq
    gllacgvaqgalrsnyvlkghrdvqrtlspgnqlyhliqnwphyrsp