PDB entry 1yci

View 1yci on RCSB PDB site
Description: Factor inhibiting HIF-1 alpha in complex with N-(carboxycarbonyl)-D-phenylalanine
Class: Transcription regulator, oxidoreductase
Keywords: fih, hif, dsbh, oxygenase, transcription, hypoxia, inhibitor 2-oxoglutarate, asparaginyl hydroxylase, hydroxylase n-(carboxycarbonyl)-d-phenylalanine, nofd, ndf
Deposited on 2004-12-22, released 2005-05-31
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.21
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypoxia-inducible factor 1 alpha inhibitor
    Species: HOMO SAPIENS
    Gene: HIF1AN
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ycia1
  • Heterogens: FE2, SO4, NDF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yciA (A:)
    maataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelienee
    pvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnr
    eemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwg
    qltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqs
    qvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykga
    ptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yciA (A:)
    gepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvypa
    lkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefveklq
    diqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligmeg
    nvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyerfp
    nfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieyplkah
    qkvaimrniekmlgealgnpqevgpllntmikgryn