PDB entry 1ych

View 1ych on RCSB PDB site
Description: X-ray Crystal Structures of Moorella thermoacetica FprA. Novel Diiron Site Structure and Mechanistic Insights into a Scavenging Nitric Oxide Reductase
Class: oxidoreductase
Keywords: Nitric Oxide, reductase, diiron site, OXIDOREDUCTASE
Deposited on 2004-12-22, released 2005-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-21, with a file datestamp of 2016-09-16.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric oxide reductase
    Species: Moorella thermoacetica [TaxId:1525]
    Gene: fprA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ycha1, d1ycha2
  • Chain 'B':
    Compound: Nitric oxide reductase
    Species: Moorella thermoacetica [TaxId:1525]
    Gene: fprA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ychb1, d1ychb2
  • Chain 'C':
    Compound: Nitric oxide reductase
    Species: Moorella thermoacetica [TaxId:1525]
    Gene: fprA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ychc1, d1ychc2
  • Chain 'D':
    Compound: Nitric oxide reductase
    Species: Moorella thermoacetica [TaxId:1525]
    Gene: fprA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ychd1, d1ychd2
  • Heterogens: ZN, FEO, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ychA (A:)
    sqpvaitdgiywvgavdwniryfhgpafsthrgttynaylivddktalvdtvyepfkeel
    iaklkqikdpvkldylvvnhtesdhagafpaimelcpdahvlctqrafdslkahyshidf
    nytivktgtsvslgkrsltfieapmlhwpdsmftyvpeealllpndafgqhiatsvrfdd
    qvdaglimdeaakyyanilmpfsnlitkkldeiqkinlaiktiapshgiiwrkdpgriie
    ayarwaegqgkakaviaydtmwlstekmahalmdglvaggcevklfklsvsdrndvikei
    ldaravlvgsptinndilpvvspllddlvglrpknkvglafgaygwgggaqkileerlka
    akieliaepgptvqwvprgedlqrcyelgrkiaariad
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ychB (B:)
    sqpvaitdgiywvgavdwniryfhgpafsthrgttynaylivddktalvdtvyepfkeel
    iaklkqikdpvkldylvvnhtesdhagafpaimelcpdahvlctqrafdslkahyshidf
    nytivktgtsvslgkrsltfieapmlhwpdsmftyvpeealllpndafgqhiatsvrfdd
    qvdaglimdeaakyyanilmpfsnlitkkldeiqkinlaiktiapshgiiwrkdpgriie
    ayarwaegqgkakaviaydtmwlstekmahalmdglvaggcevklfklsvsdrndvikei
    ldaravlvgsptinndilpvvspllddlvglrpknkvglafgaygwgggaqkileerlka
    akieliaepgptvqwvprgedlqrcyelgrkiaariad
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ychC (C:)
    sqpvaitdgiywvgavdwniryfhgpafsthrgttynaylivddktalvdtvyepfkeel
    iaklkqikdpvkldylvvnhtesdhagafpaimelcpdahvlctqrafdslkahyshidf
    nytivktgtsvslgkrsltfieapmlhwpdsmftyvpeealllpndafgqhiatsvrfdd
    qvdaglimdeaakyyanilmpfsnlitkkldeiqkinlaiktiapshgiiwrkdpgriie
    ayarwaegqgkakaviaydtmwlstekmahalmdglvaggcevklfklsvsdrndvikei
    ldaravlvgsptinndilpvvspllddlvglrpknkvglafgaygwgggaqkileerlka
    akieliaepgptvqwvprgedlqrcyelgrkiaariad
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ychD (D:)
    sqpvaitdgiywvgavdwniryfhgpafsthrgttynaylivddktalvdtvyepfkeel
    iaklkqikdpvkldylvvnhtesdhagafpaimelcpdahvlctqrafdslkahyshidf
    nytivktgtsvslgkrsltfieapmlhwpdsmftyvpeealllpndafgqhiatsvrfdd
    qvdaglimdeaakyyanilmpfsnlitkkldeiqkinlaiktiapshgiiwrkdpgriie
    ayarwaegqgkakaviaydtmwlstekmahalmdglvaggcevklfklsvsdrndvikei
    ldaravlvgsptinndilpvvspllddlvglrpknkvglafgaygwgggaqkileerlka
    akieliaepgptvqwvprgedlqrcyelgrkiaariad