PDB entry 1ycg

View 1ycg on RCSB PDB site
Description: X-ray Structures of Moorella thermoacetica FprA. Novel Diiron Site Structure and Mechanistic Insights into a Scavenging Nitric Oxide Reductase
Class: oxidoreductase
Keywords: Nitric oxide, reductase, diiron site, OXIDOREDUCTASE
Deposited on 2004-12-22, released 2005-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-21, with a file datestamp of 2016-09-16.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric oxide reductase
    Species: Moorella thermoacetica [TaxId:1525]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ycga1, d1ycga2
  • Chain 'B':
    Compound: Nitric oxide reductase
    Species: Moorella thermoacetica [TaxId:1525]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ycgb1, d1ycgb2
  • Chain 'C':
    Compound: Nitric oxide reductase
    Species: Moorella thermoacetica [TaxId:1525]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ycgc1, d1ycgc2
  • Chain 'D':
    Compound: Nitric oxide reductase
    Species: Moorella thermoacetica [TaxId:1525]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ycgd1, d1ycgd2
  • Heterogens: ZN, FEO, EDO, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ycgA (A:)
    sqpvaitdgiywvgavdwniryfhgpafsthrgttynaylivddktalvdtvyepfkeel
    iaklkqikdpvkldylvvnhtesdhagafpaimelcpdahvlctqrafdslkahyshidf
    nytivktgtsvslgkrsltfieapmlhwpdsmftyvpeealllpndafgqhiatsvrfdd
    qvdaglimdeaakyyanilmpfsnlitkkldeiqkinlaiktiapshgiiwrkdpgriie
    ayarwaegqgkakaviaydtmwlstekmahalmdglvaggcevklfklsvsdrndvikei
    ldaravlvgsptinndilpvvspllddlvglrpknkvglafgaygwgggaqkileerlka
    akieliaepgptvqwvprgedlqrcyelgrkiaariad
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ycgB (B:)
    sqpvaitdgiywvgavdwniryfhgpafsthrgttynaylivddktalvdtvyepfkeel
    iaklkqikdpvkldylvvnhtesdhagafpaimelcpdahvlctqrafdslkahyshidf
    nytivktgtsvslgkrsltfieapmlhwpdsmftyvpeealllpndafgqhiatsvrfdd
    qvdaglimdeaakyyanilmpfsnlitkkldeiqkinlaiktiapshgiiwrkdpgriie
    ayarwaegqgkakaviaydtmwlstekmahalmdglvaggcevklfklsvsdrndvikei
    ldaravlvgsptinndilpvvspllddlvglrpknkvglafgaygwgggaqkileerlka
    akieliaepgptvqwvprgedlqrcyelgrkiaariad
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ycgC (C:)
    sqpvaitdgiywvgavdwniryfhgpafsthrgttynaylivddktalvdtvyepfkeel
    iaklkqikdpvkldylvvnhtesdhagafpaimelcpdahvlctqrafdslkahyshidf
    nytivktgtsvslgkrsltfieapmlhwpdsmftyvpeealllpndafgqhiatsvrfdd
    qvdaglimdeaakyyanilmpfsnlitkkldeiqkinlaiktiapshgiiwrkdpgriie
    ayarwaegqgkakaviaydtmwlstekmahalmdglvaggcevklfklsvsdrndvikei
    ldaravlvgsptinndilpvvspllddlvglrpknkvglafgaygwgggaqkileerlka
    akieliaepgptvqwvprgedlqrcyelgrkiaariad
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ycgD (D:)
    sqpvaitdgiywvgavdwniryfhgpafsthrgttynaylivddktalvdtvyepfkeel
    iaklkqikdpvkldylvvnhtesdhagafpaimelcpdahvlctqrafdslkahyshidf
    nytivktgtsvslgkrsltfieapmlhwpdsmftyvpeealllpndafgqhiatsvrfdd
    qvdaglimdeaakyyanilmpfsnlitkkldeiqkinlaiktiapshgiiwrkdpgriie
    ayarwaegqgkakaviaydtmwlstekmahalmdglvaggcevklfklsvsdrndvikei
    ldaravlvgsptinndilpvvspllddlvglrpknkvglafgaygwgggaqkileerlka
    akieliaepgptvqwvprgedlqrcyelgrkiaariad