PDB entry 1yce

View 1yce on RCSB PDB site
Description: Structure of the rotor ring of F-type Na+-ATPase from Ilyobacter tartaricus
Deposited on 2004-12-22, released 2005-04-12
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.203
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'B':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'C':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'D':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'E':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'F':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'G':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'H':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'I':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'J':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'K':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'L':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'M':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'N':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'O':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'P':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'Q':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'R':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'S':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'T':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'U':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'V':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'a':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'b':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'c':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'd':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'e':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'f':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'g':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'h':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'i':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'j':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'k':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'l':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'm':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'n':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'o':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'p':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'q':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'r':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 's':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 't':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'u':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Chain 'v':
    Compound: subunit c
    Species: Ilyobacter tartaricus [TaxId:167644]
    Database cross-references and differences (RAF-indexed):
    • GB AAM94908 (0-88)
  • Heterogens: NA, F09, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1yceA (A:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1yceB (B:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1yceC (C:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >1yceD (D:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >1yceE (E:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >1yceF (F:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records:
    >1yceG (G:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records:
    >1yceH (H:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >1yceI (I:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records:
    >1yceJ (J:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records:
    >1yceK (K:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records:
    >1yceL (L:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records:
    >1yceM (M:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records:
    >1yceN (N:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records:
    >1yceO (O:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records:
    >1yceP (P:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records:
    >1yceQ (Q:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records:
    >1yceR (R:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records:
    >1yceS (S:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records:
    >1yceT (T:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records:
    >1yceU (U:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records:
    >1yceV (V:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'a':
    Sequence; same for both SEQRES and ATOM records:
    >1ycea (a:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'b':
    Sequence; same for both SEQRES and ATOM records:
    >1yceb (b:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'c':
    Sequence; same for both SEQRES and ATOM records:
    >1ycec (c:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'd':
    Sequence; same for both SEQRES and ATOM records:
    >1yced (d:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'e':
    Sequence; same for both SEQRES and ATOM records:
    >1ycee (e:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'f':
    Sequence; same for both SEQRES and ATOM records:
    >1ycef (f:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'g':
    Sequence; same for both SEQRES and ATOM records:
    >1yceg (g:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'h':
    Sequence; same for both SEQRES and ATOM records:
    >1yceh (h:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'i':
    Sequence; same for both SEQRES and ATOM records:
    >1ycei (i:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'j':
    Sequence; same for both SEQRES and ATOM records:
    >1ycej (j:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'k':
    Sequence; same for both SEQRES and ATOM records:
    >1ycek (k:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'l':
    Sequence; same for both SEQRES and ATOM records:
    >1ycel (l:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'm':
    Sequence; same for both SEQRES and ATOM records:
    >1ycem (m:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'n':
    Sequence; same for both SEQRES and ATOM records:
    >1ycen (n:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'o':
    Sequence; same for both SEQRES and ATOM records:
    >1yceo (o:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'p':
    Sequence; same for both SEQRES and ATOM records:
    >1ycep (p:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'q':
    Sequence; same for both SEQRES and ATOM records:
    >1yceq (q:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'r':
    Sequence; same for both SEQRES and ATOM records:
    >1ycer (r:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 's':
    Sequence; same for both SEQRES and ATOM records:
    >1yces (s:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 't':
    Sequence; same for both SEQRES and ATOM records:
    >1ycet (t:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'u':
    Sequence; same for both SEQRES and ATOM records:
    >1yceu (u:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg
    

  • Chain 'v':
    Sequence; same for both SEQRES and ATOM records:
    >1ycev (v:)
    mdmlfaktvvlaasavgagtamiagigpgvgqgyaagkavesvarqpeakgdiistmvlg
    qavaestgiyslvialillyanpfvgllg