PDB entry 1ycd

View 1ycd on RCSB PDB site
Description: Crystal structure of yeast FSH1/YHR049W, a member of the serine hydrolase family
Deposited on 2004-12-22, released 2005-05-10
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.167
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YHR049w
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38777
      • engineered (108)
  • Chain 'B':
    Compound: Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YHR049w
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38777
      • engineered (108)
  • Heterogens: LI5, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ycdA (A:)
    mtvqipkllflhgflqngkvfsekssgirkllkkanvqcdyidapvllekkdlpfemdde
    kwqatldadvnrawfyhseisheldiseglksvvdhikangpydgivglsqgaalssiit
    nkiselvpdhpqfkvsvvisgysftepdpehpgelritekfrdsfavkpdmktkmifiyg
    asdqavpsvrskylydiylkaqngnkekvlayehpgghmvpnkkdiirpiveqitsslqe
    ase
    

    Sequence, based on observed residues (ATOM records):
    >1ycdA (A:)
    vqipkllflhgflqngkvfsekssgirkllkkanvqcdyidapvllekkdlpfemddekw
    qatldadvnrawfyhseisheldiseglksvvdhikangpydgivglsqgaalssiitnk
    iselvpdhpqfkvsvvisgysftepdpehpgelritekfrdsfavkpdmktkmifiygas
    dqavpsvrskylydiylkaqngnkekvlayehpgghmvpnkkdiirpiveqitsslq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1ycdB (B:)
    mtvqipkllflhgflqngkvfsekssgirkllkkanvqcdyidapvllekkdlpfemdde
    kwqatldadvnrawfyhseisheldiseglksvvdhikangpydgivglsqgaalssiit
    nkiselvpdhpqfkvsvvisgysftepdpehpgelritekfrdsfavkpdmktkmifiyg
    asdqavpsvrskylydiylkaqngnkekvlayehpgghmvpnkkdiirpiveqitsslqe
    ase
    

    Sequence, based on observed residues (ATOM records):
    >1ycdB (B:)
    qipkllflhgflqngkvfsekssgirkllkkanvqcdyidapvllekkdlpfemddekwq
    atldadvnrawfyhseisheldiseglksvvdhikangpydgivglsqgaalssiitnki
    selvpdhpqfkvsvvisgysftepdpehpgelritekfrdsfavkpdmktkmifiygasd
    qavpsvrskylydiylkaqngnkekvlayehpgghmvpnkkdiirpiveqitsslqea