PDB entry 1ycb

View 1ycb on RCSB PDB site
Description: distal pocket polarity in ligand binding to myoglobin: deoxy and carbonmonoxy forms of a threonine68 (e11) mutant investigated by x-ray crystallography and infrared spectroscopy
Deposited on 1993-08-10, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.1 Å
R-factor: 0.198
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ycba_
  • Chain 'B':
    Domains in SCOP 1.55: d1ycbb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ycbA (A:)
    glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
    lkkhgnttltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
    gdfgadaqgamskalelfrndmaakykelgfqg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ycbB (B:)
    glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
    lkkhgnttltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
    gdfgadaqgamskalelfrndmaakykelgfqg