PDB entry 1yc9

View 1yc9 on RCSB PDB site
Description: The crystal structure of the outer membrane protein VceC from the bacterial pathogen Vibrio cholerae at 1.8 resolution
Class: membrane protein
Keywords: Vibrio cholerae, outer membrane protein, multidrug resistance, MEMBRANE PROTEIN
Deposited on 2004-12-22, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: multidrug resistance protein
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KS51
      • engineered (49)
      • conflict (353)
      • conflict (355)
    Domains in SCOPe 2.07: d1yc9a_
  • Heterogens: BOG, HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yc9A (A:)
    mweanelsstntfshqaemdwpsanwwqryqdaqlnhlieealqhspslcmamarlkgaq
    gfarqagairsfdlglaasateskvseryqsatppdgwndygtltlnfqydfdfwgknra
    avvaatselaaaeaesvaarlmistsianayaelarlyanqetvhaalqvrnktvellek
    ryangletlgsvsqakavaasveaellgiqesiqlqknalaalvgqgpdraasieephit
    ltsryglpseagvgllghraditaarwraeaaaqqvgiaqaqfypdvtlsafigyqafgl
    dhlfdsgndagaigpaiylplftggrlegqltsaearyqeavaqyngtlvqalheiadvv
    tssqalqarinkteqavqqaeqalhiatnryqgglatyldvlvaeesllnnqralvnlqs
    rafsldlalihalgggfettes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yc9A (A:)
    wpsanwwqryqdaqlnhlieealqhspslcmamarlkgaqgfarqagairsfdlglaasa
    teskvseryqsatppdgwndygtltlnfqydfdfwgknraavvaatselaaaeaesvaar
    lmistsianayaelarlyanqetvhaalqvrnktvellekryangletlgsvsqakavaa
    sveaellgiqesiqlqknalaalvgqgpdraasieephitltsryvgllghraditaarw
    raeaaaqqvgiaqaqfypdvtlsafigyqafgldhlfdsgndagaigpaiylplftggrl
    egqltsaearyqeavaqyngtlvqalheiadvvtssqalqarinkteqavqqaeqalhia
    tnryqgglatyldvlvaeesllnnqralvnlqsrafsldlalihalgggfe