PDB entry 1yc6

View 1yc6 on RCSB PDB site
Description: Crystallographic Structure of the T=1 Particle of Brome Mosaic Virus
Class: Virus
Keywords: Structural Transition, Proteolysis, BMV, AlMV, Symmetry, Assembly, Icosahedral virus, Virus
Deposited on 2004-12-22, released 2005-01-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.219
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc61_
  • Chain '2':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc62_
  • Chain '3':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc63_
  • Chain '4':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc64_
  • Chain 'A':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6a_
  • Chain 'B':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6b_
  • Chain 'C':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6c_
  • Chain 'D':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6d_
  • Chain 'E':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6e_
  • Chain 'F':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6f_
  • Chain 'G':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6g_
  • Chain 'H':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6h_
  • Chain 'I':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6i_
  • Chain 'J':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6j_
  • Chain 'K':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6k_
  • Chain 'L':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6l_
  • Chain 'M':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6m_
  • Chain 'N':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6n_
  • Chain 'O':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6o_
  • Chain 'P':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6p_
  • Chain 'Q':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6q_
  • Chain 'R':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6r_
  • Chain 'S':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6s_
  • Chain 'T':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6t_
  • Chain 'U':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6u_
  • Chain 'V':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6v_
  • Chain 'W':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6w_
  • Chain 'X':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6x_
  • Chain 'Y':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6y_
  • Chain 'Z':
    Compound: coat protein
    Species: Brome mosaic virus [TaxId:12302]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1yc6z_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc61 (1:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc62 (2:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc63 (3:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc64 (4:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6A (A:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6B (B:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6C (C:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6D (D:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6E (E:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6F (F:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6G (G:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6H (H:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6I (I:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6J (J:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6K (K:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6L (L:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6M (M:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6N (N:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6O (O:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6P (P:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6Q (Q:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6R (R:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6S (S:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6T (T:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6U (U:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6V (V:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6W (W:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6X (X:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6Y (Y:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yc6Z (Z:)
    aagqgkaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlg
    llpsvagrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiy
    lyaseavpakavvvhlevehvrptfddfftpvyr