PDB entry 1yc5

View 1yc5 on RCSB PDB site
Description: Sir2-p53 peptide-nicotinamide
Class: hydrolase
Keywords: sir2, sirtuin, sir2Tm, SirT1, p53, nicotinamide, HYDROLASE
Deposited on 2004-12-21, released 2005-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.186
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent deacetylase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: npdA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yc5a1
  • Chain 'B':
    Compound: Cellular tumor antigen p53 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP68
      • modified residue (10)
  • Heterogens: ZN, NCA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yc5A (A:)
    mkmkefldllnesrltvtltgagistpsgipdfrgpngiykkysqnvfdidffyshpeef
    yrfakegifpmlqakpnlahvllakleekglieavitqnidrlhqragskkvielhgnve
    eyycvrcekkytvedvikklessdvplcddcnslirpnivffgenlpqdalreaiglssr
    aslmivlgsslvvypaaelplitvrsggklvivnlgetpfddiatlkynmdvvefarrvm
    eeggis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yc5A (A:)
    mkmkefldllnesrltvtltgagistpsgipdfqnvfdidffyshpeefyrfakegifpm
    lqakpnlahvllakleekglieavitqnidrlhqragskkvielhgnveeyycvrcekky
    tvedvikklessdvplcddcnslirpnivffgenlpqdalreaiglssraslmivlgssl
    vvypaaelplitvrsggklvivnlgetpfddiatlkynmdvvefarrvmeeggi
    

  • Chain 'B':
    No sequence available.