PDB entry 1yc3

View 1yc3 on RCSB PDB site
Description: Crystal Structure of human HSP90alpha complexed with dihydroxyphenylpyrazoles
Class: cell cycle
Keywords: cell-cycle, cancer, drug design, CELL CYCLE
Deposited on 2004-12-21, released 2005-02-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.184
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSPCA, HSP90A, HSPC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1yc3a_
  • Heterogens: 4BC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yc3A (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdrwgsdqpmeeeevetfafqaeiaqlmsl
    iintfysnkeiflrelisnssdaldkiryetltdpskldsgkelhinlipnkqdrtltiv
    dtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgvgfysaylvaekvtvit
    khnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqteyleerrikeivkkhsq
    figypitlfvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yc3A (A:)
    qpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryetltdpsk
    ldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadis
    migqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilh
    lkedqteyleerrikeivkkhsqfigypitlfve