PDB entry 1yc0

View 1yc0 on RCSB PDB site
Description: short form HGFA with first Kunitz domain from HAI-1
Class: hydrolase/inhibitor
Keywords: HYDROLASE/INHIBITOR, HYDROLASE-INHIBITOR complex
Deposited on 2004-12-21, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.196
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor activator
    Species: Homo sapiens [TaxId:9606]
    Gene: HGFAC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yc0a_
  • Chain 'I':
    Compound: Kunitz-type protease inhibitor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SPINT1, HAI1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43278 (16-74)
      • cloning artifact (9-15)
    Domains in SCOPe 2.07: d1yc0i1, d1yc0i2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yc0A (A:)
    vqlspdllatlpepaspgrqacgrrhkkrtflrpriiggssslpgshpwlaaiyigdsfc
    agslvhtcwvvsaahcfshspprdsvsvvlgqhffnrttdvtqtfgiekyipytlysvfn
    psdhdlvlirlkkkgdrcatrsqfvqpiclpepgstfpaghkcqiagwghldenvsgyss
    slrealvplvadhkcsspevygadispnmlcagyfdcksdacqgdsggplacekngvayl
    ygiiswgdgcgrlhkpgvytrvanyvdwindrirpprrlvaps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yc0A (A:)
    acgrrhkkiiggssslpgshpwlaaiyigdsfcagslvhtcwvvsaahcfshspprdsvs
    vvlgqhffnrttdvtqtfgiekyipytlysvfnpsdhdlvlirlkkkgdrcatrsqfvqp
    iclpepgstfpaghkcqiagwghldenvsgyssslrealvplvadhkcsspevygadisp
    nmlcagyfdcksdacqgdsggplacekngvaylygiiswgdgcgrlhkpgvytrvanyvd
    windrir
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1yc0I (I:)
    mkhqhqhqhqhqhqmhqtedyclasnkvgrcrgsfprwyydpteqicksfvyggclgnkn
    nylreeecilacrgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yc0I (I:)
    qhqhqmhqtedyclasnkvgrcrgsfprwyydpteqicksfvyggclgnknnylreeeci
    lacrgv