PDB entry 1ybz

View 1ybz on RCSB PDB site
Description: Conserved hypothetical protein from Pyrococcus furiosus Pfu-1581948-001
Class: isomerase
Keywords: conserved hypothetical protein, Pyrococcus furiosus, hyperthermophile, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, Isomerase
Deposited on 2004-12-21, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chorismate mutase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U098 (16-End)
      • cloning artifact (14-15)
    Domains in SCOPe 2.07: d1ybza1, d1ybza2
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ybzA (A:)
    ahhhhhhenlyfqagsttlkllrkeidkidnqiisllkkrleiaqaigkikkelnlpied
    rkreeevlrragefreifekilevskdvqrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybzA (A:)
    gsttlkllrkeidkidnqiisllkkrleiaqaigkikkelnlpiedrkreeevlrragef
    reifekilevskdvqr