PDB entry 1yby

View 1yby on RCSB PDB site
Description: conserved hypothetical protein cth-95 from clostridium thermocellum
Deposited on 2004-12-21, released 2005-02-01
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation elongation factor P
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00311326 (30-214)
      • modified residue (30)
      • modified residue (89)
      • modified residue (99)
      • modified residue (112)
      • modified residue (211)
  • Chain 'B':
    Compound: Translation elongation factor P
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00311326 (30-214)
      • modified residue (30)
      • modified residue (89)
      • modified residue (99)
      • modified residue (112)
      • modified residue (211)
  • Heterogens: UNX, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ybyA (A:)
    mgsshhhhhhssglvprgsqstslykkaglmisagdfkngvtfeldgqifqviefqhvkp
    gkgaafvrtklknivtgatiektfnptdkmpkahierkdmqylyndgdlyyfmdtetfeq
    lplgkdkigdalkfvkeneivkvlshkgnvfgieppnfvelevtdtepgfkgdtatgatk
    paivetgasikvplfvnkgdiiridtrtgeymerv
    

    Sequence, based on observed residues (ATOM records):
    >1ybyA (A:)
    misagdfkngvtfeldgqifqviefqhvkpgaafvrtklknivtgatiektfnptdkmpk
    ahierkdmqylyndgdlyyfmdtetfeqlplgkdkigdalkfvkeneivkvlshkgnvfg
    ieppnfvelevtdttatgatkpaivetgasikvplfvnkgdiiridtrtgeymerv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1ybyB (B:)
    mgsshhhhhhssglvprgsqstslykkaglmisagdfkngvtfeldgqifqviefqhvkp
    gkgaafvrtklknivtgatiektfnptdkmpkahierkdmqylyndgdlyyfmdtetfeq
    lplgkdkigdalkfvkeneivkvlshkgnvfgieppnfvelevtdtepgfkgdtatgatk
    paivetgasikvplfvnkgdiiridtrtgeymerv
    

    Sequence, based on observed residues (ATOM records):
    >1ybyB (B:)
    misagdfkngvtfeldgqifqviefqhvkpgkgaafvrtklknivtgatiektfnptdkm
    pkahierkdmqylyndgdlyyfmdtetfeqlplgkdkigdalkfvkeneivkvlshkgnv
    fgieppnfvelevtdtepgfatkpaivetgasikvplfvnkgdiiridtrtgeymerv