PDB entry 1ybx

View 1ybx on RCSB PDB site
Description: Conserved hypothetical protein Cth-383 from Clostridium thermocellum
Class: structural genomics, unknown function
Keywords: conserved hypothetical protein, Clostridium thermocellum, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, unknown function
Deposited on 2004-12-21, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00311451
      • modified residue (52)
      • modified residue (56)
      • modified residue (104)
      • modified residue (123)
    Domains in SCOPe 2.07: d1ybxa_
  • Chain 'B':
    Compound: conserved hypothetical protein
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00311451
      • modified residue (52)
      • modified residue (56)
      • modified residue (104)
      • modified residue (123)
    Domains in SCOPe 2.07: d1ybxb_
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ybxA (A:)
    mgsshhhhhhssglvprgsqstslykkaglmakggfpgfggninnlvkqaqkmqrdmerv
    qeelkektveasagggavtvvatgrkdikeitikpevvdpddvemlqdlilaavnealrk
    ademvtaeiskitgglggipglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybxA (A:)
    innlvkqaqkmqrdmervqeelkektveasagggavtvvatgrkdikeitikpevvdpdd
    vemlqdlilaavnealrkademvtaeiskit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ybxB (B:)
    mgsshhhhhhssglvprgsqstslykkaglmakggfpgfggninnlvkqaqkmqrdmerv
    qeelkektveasagggavtvvatgrkdikeitikpevvdpddvemlqdlilaavnealrk
    ademvtaeiskitgglggipglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybxB (B:)
    ninnlvkqaqkmqrdmervqeelkektveasagggavtvvatgrkdikeitikpevvdpd
    dvemlqdlilaavnealrkademvtaeiskit