PDB entry 1ybw

View 1ybw on RCSB PDB site
Description: Protease domain of HGFA with no inhibitor
Class: hydrolase
Keywords: hydrolase
Deposited on 2004-12-21, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.218
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor activator precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: HGFAC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ybwa_
  • Chain 'B':
    Compound: Hepatocyte growth factor activator precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: HGFAC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ybwb_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ybwA (A:)
    vqlspdllatlpepaspgrqacgrrhkkrtflrpriiggssslpgshpwlaaiyigdsfc
    agslvhtcwvvsaahcfshspprdsvsvvlgqhffnrttdvtqtfgiekyipytlysvfn
    psdhdlvlirlkkkgdrcatrsqfvqpiclpepgstfpaghkcqiagwghldenvsgyss
    slrealvplvadhkcsspevygadispnmlcagyfdcksdacqgdsggplacekngvayl
    ygiiswgdgcgrlhkpgvytrvanyvdwindrirpprrlvaps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybwA (A:)
    acgrrhkkiiggssslpgshpwlaaiyigdsfcagslvhtcwvvsaahcfshspprdsvs
    vvlgqhffnrttdvtqtfgiekyipytlysvfnpsdhdlvlirlkkkgdrcatrsqfvqp
    iclpepgstfpaghkcqiagwghldenvsgyssslrealvplvadhkcsspevygadisp
    nmlcagyfdcksdacqgdsggplacekngvaylygiiswgdgcgrlhkpgvytrvanyvd
    windri
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ybwB (B:)
    vqlspdllatlpepaspgrqacgrrhkkrtflrpriiggssslpgshpwlaaiyigdsfc
    agslvhtcwvvsaahcfshspprdsvsvvlgqhffnrttdvtqtfgiekyipytlysvfn
    psdhdlvlirlkkkgdrcatrsqfvqpiclpepgstfpaghkcqiagwghldenvsgyss
    slrealvplvadhkcsspevygadispnmlcagyfdcksdacqgdsggplacekngvayl
    ygiiswgdgcgrlhkpgvytrvanyvdwindrirpprrlvaps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybwB (B:)
    acgrrhkkiiggssslpgshpwlaaiyigdsfcagslvhtcwvvsaahcfshspprdsvs
    vvlgqhffnrttdvtqtfgiekyipytlysvfnpsdhdlvlirlkkkgdrcatrsqfvqp
    iclpepgstfpaghkcqiagwghldenvsgyssslrealvplvadhkcsspevygadisp
    nmlcagyfdcksdacqgdsggplacekngvaylygiiswgdgcgrlhkpgvytrvanyvd
    windri