PDB entry 1ybv

View 1ybv on RCSB PDB site
Description: structure of trihydroxynaphthalene reductase in complex with nadph and an active site inhibitor
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1996-09-23, released 1997-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.223
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trihydroxynaphthalene reductase
    Species: Magnaporthe grisea [TaxId:148305]
    Gene: BUF+
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12634 (Start-282)
      • conflict (240)
      • engineered (241)
      • engineered (246)
    Domains in SCOPe 2.07: d1ybva_
  • Chain 'B':
    Compound: trihydroxynaphthalene reductase
    Species: Magnaporthe grisea [TaxId:148305]
    Gene: BUF+
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12634 (Start-282)
      • conflict (240)
      • engineered (241)
      • engineered (246)
    Domains in SCOPe 2.07: d1ybvb_
  • Heterogens: NDP, BEA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ybvA (A:)
    maavtqprgeskydaipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivny
    anstesaeevvaaikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsf
    ghvkdvtpeefdrvftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysg
    skgaietfarcmaidmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaa
    vqwsplrrvglpidiarvvcflasndggwvtgkvigidggacm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybvA (A:)
    daipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivnyanstesaeevvaa
    ikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsfghvkdvtpeefdr
    vftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysgskgaietfarcma
    idmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaavqwsplrrvglpi
    diarvvcflasndggwvtgkvigidggacm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ybvB (B:)
    maavtqprgeskydaipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivny
    anstesaeevvaaikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsf
    ghvkdvtpeefdrvftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysg
    skgaietfarcmaidmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaa
    vqwsplrrvglpidiarvvcflasndggwvtgkvigidggacm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybvB (B:)
    daipgplgpqsaslegkvalvtgagrgigremamelgrrgckvivnyanstesaeevvaa
    ikkngsdaacvkanvgvvedivrmfeeavkifgkldivcsnsgvvsfghvkdvtpeefdr
    vftintrgqffvareaykhleiggrlilmgsitgqakavpkhavysgskgaietfarcma
    idmadkkitvnvvapggiktdmyhavcreyipngenlsneevdeyaavqwsplrrvglpi
    diarvvcflasndggwvtgkvigidggacm