PDB entry 1ybu

View 1ybu on RCSB PDB site
Description: Mycobacterium tuberculosis adenylyl cyclase Rv1900c CHD, in complex with a substrate analog.
Class: hydrolase
Keywords: Cyclase homology domain, CHD, Rv1900c, HYDROLASE
Deposited on 2004-12-21, released 2005-02-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipJ
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv1900c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ybua_
  • Chain 'B':
    Compound: lipJ
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv1900c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ybub_
  • Chain 'C':
    Compound: lipJ
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv1900c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ybuc_
  • Chain 'D':
    Compound: lipJ
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv1900c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ybud_
  • Heterogens: MN, APC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ybuA (A:)
    mrgshhhhhhgsaermlatimftdivgstqhaaalgddrwrdlldnhdtivcheiqrfgg
    revntagdgfvatftspsaaiacaddivdavaalgievrigihagevevrdashgtdvag
    vavhigarvcalagpsevlvsstvrdivagsrhrfaergeqelkgvpgrwrlcvlmrdda
    trtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybuA (A:)
    aermlatimftdivgstqhaaalgddrwrdlldnhdtivcheiqrfggrevntagdgfva
    tftspsaaiacaddivdavaalgievrigihagevevrdashgtdvagvavhigarvcal
    agpsevlvsstvrdivagsrhrfaergeqelkgvpgrwrlcvlmrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ybuB (B:)
    mrgshhhhhhgsaermlatimftdivgstqhaaalgddrwrdlldnhdtivcheiqrfgg
    revntagdgfvatftspsaaiacaddivdavaalgievrigihagevevrdashgtdvag
    vavhigarvcalagpsevlvsstvrdivagsrhrfaergeqelkgvpgrwrlcvlmrdda
    trtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybuB (B:)
    aermlatimftdivgstqhaaalgddrwrdlldnhdtivcheiqrfggrevntagdgfva
    tftspsaaiacaddivdavaalgievrigihagevevrdatdvagvavhigarvcalagp
    sevlvsstvrdivagsrhrfaergeqelkgvpgrwrlcvlmrd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ybuC (C:)
    mrgshhhhhhgsaermlatimftdivgstqhaaalgddrwrdlldnhdtivcheiqrfgg
    revntagdgfvatftspsaaiacaddivdavaalgievrigihagevevrdashgtdvag
    vavhigarvcalagpsevlvsstvrdivagsrhrfaergeqelkgvpgrwrlcvlmrdda
    trtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybuC (C:)
    aermlatimftdivgstqhaaalgddrwrdlldnhdtivcheiqrfggrevntagdgfva
    tftspsaaiacaddivdavaalgievrigihagevevrdatdvagvavhigarvcalagp
    sevlvsstvrdivagsrhrfaergeqelkgvpgrwrlcvlmrd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ybuD (D:)
    mrgshhhhhhgsaermlatimftdivgstqhaaalgddrwrdlldnhdtivcheiqrfgg
    revntagdgfvatftspsaaiacaddivdavaalgievrigihagevevrdashgtdvag
    vavhigarvcalagpsevlvsstvrdivagsrhrfaergeqelkgvpgrwrlcvlmrdda
    trtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybuD (D:)
    aermlatimftdivgstqhaaalgddrwrdlldnhdtivcheiqrfggrevntagdgfva
    tftspsaaiacaddivdavaalgievrigihagevevrdashgtdvagvavhigarvcal
    agpsevlvsstvrdivagsrhrfaergeqelkgvpgrwrlcvlmrd