PDB entry 1ybt

View 1ybt on RCSB PDB site
Description: mycobacterium tuberculosis adenylyl cyclase, rv1900c chd
Class: hydrolase
Keywords: Cyclase homology domain, CHD, Rv1900c, HYDROLASE
Deposited on 2004-12-21, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.194
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydrolase, alpha/beta hydrolase fold family
    Species: Mycobacterium tuberculosis [TaxId:83331]
    Gene: Rv1900c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07732 (12-End)
      • modified residue (15)
      • modified residue (20)
      • modified residue (175)
      • cloning artifact (15)
    Domains in SCOPe 2.07: d1ybta_
  • Chain 'B':
    Compound: hydrolase, alpha/beta hydrolase fold family
    Species: Mycobacterium tuberculosis [TaxId:83331]
    Gene: Rv1900c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07732 (12-183)
      • modified residue (15)
      • modified residue (20)
      • modified residue (175)
      • cloning artifact (15)
    Domains in SCOPe 2.07: d1ybtb_
  • Chain 'C':
    Compound: hydrolase, alpha/beta hydrolase fold family
    Species: Mycobacterium tuberculosis [TaxId:83331]
    Gene: Rv1900c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07732 (12-183)
      • modified residue (15)
      • modified residue (20)
      • modified residue (175)
      • cloning artifact (15)
    Domains in SCOPe 2.07: d1ybtc_
  • Chain 'D':
    Compound: hydrolase, alpha/beta hydrolase fold family
    Species: Mycobacterium tuberculosis [TaxId:83331]
    Gene: Rv1900c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O07732 (12-End)
      • modified residue (15)
      • modified residue (20)
      • modified residue (175)
      • cloning artifact (15)
    Domains in SCOPe 2.07: d1ybtd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ybtA (A:)
    mrgshhhhhhgsaermlatimftdivgstqhaaalgddrwrdlldnhdtivcheiqrfgg
    revntagdgfvatftspsaaiacaddivdavaalgievrigihagevevrdashgtdvag
    vavhigarvcalagpsevlvsstvrdivagsrhrfaergeqelkgvpgrwrlcvlmrdda
    trtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybtA (A:)
    aermlatimftdivgstqhaaalgddrwrdlldnhdtivcheiqrfggrevntagdgfva
    tftspsaaiacaddivdavaalgievrigihagevevrdashgtdvagvavhigarvcal
    agpsevlvsstvrdivagsrhrfaergeqelkgvpgrwrlcvlmrdd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ybtB (B:)
    mrgshhhhhhgsaermlatimftdivgstqhaaalgddrwrdlldnhdtivcheiqrfgg
    revntagdgfvatftspsaaiacaddivdavaalgievrigihagevevrdashgtdvag
    vavhigarvcalagpsevlvsstvrdivagsrhrfaergeqelkgvpgrwrlcvlmrdda
    trtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybtB (B:)
    aermlatimftdivgstqhaaalgddrwrdlldnhdtivcheiqrfggrevntagdgfva
    tftspsaaiacaddivdavaalgievrigihagevevrdashgtdvagvavhigarvcal
    agpsevlvsstvrdivagsrhrfaergeqelkgvpgrwrlcvlmrddatrtr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ybtC (C:)
    mrgshhhhhhgsaermlatimftdivgstqhaaalgddrwrdlldnhdtivcheiqrfgg
    revntagdgfvatftspsaaiacaddivdavaalgievrigihagevevrdashgtdvag
    vavhigarvcalagpsevlvsstvrdivagsrhrfaergeqelkgvpgrwrlcvlmrdda
    trtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybtC (C:)
    aermlatimftdivgstqhaaalgddrwrdlldnhdtivcheiqrfggrevntagdgfva
    tftspsaaiacaddivdavaalgievrigihagevevrdashgtdvagvavhigarvcal
    agpsevlvsstvrdivagsrhrfaergeqelkgvpgrwrlcvlmrddatrtr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ybtD (D:)
    mrgshhhhhhgsaermlatimftdivgstqhaaalgddrwrdlldnhdtivcheiqrfgg
    revntagdgfvatftspsaaiacaddivdavaalgievrigihagevevrdashgtdvag
    vavhigarvcalagpsevlvsstvrdivagsrhrfaergeqelkgvpgrwrlcvlmrdda
    trtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybtD (D:)
    aermlatimftdivgstqhaaalgddrwrdlldnhdtivcheiqrfggrevntagdgfva
    tftspsaaiacaddivdavaalgievrigihagevevrdashgtdvagvavhigarvcal
    agpsevlvsstvrdivagsrhrfaergeqelkgvpgrwrlcvlmrdd