PDB entry 1ybq

View 1ybq on RCSB PDB site
Description: crystal structure of escherichia coli isoaspartyl dipeptidase mutant d285n complexed with beta-aspartylhistidine
Deposited on 2004-12-21, released 2005-04-26
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isoaspartyl dipeptidase
    Species: Escherichia coli [TaxId:562]
    Gene: iadA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39377 (0-End)
      • engineered (284)
  • Chain 'B':
    Compound: Isoaspartyl dipeptidase
    Species: Escherichia coli [TaxId:562]
    Gene: iadA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39377 (0-End)
      • engineered (284)
  • Heterogens: ZN, BDH, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ybqA (A:)
    midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
    cpgfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllakt
    ralneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlan
    maaesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeq
    alefarkggtiditssidepvapaegiaravqagiplarvtlssngngsqpffddegnlt
    higvagfetlletvqvlvkdydfsisdalrpltssvagflnltgkgeilpgndadllvmt
    pelrieqvyargklmvkdgkacvkgtfeta
    

    Sequence, based on observed residues (ATOM records):
    >1ybqA (A:)
    midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
    cpgfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllakt
    ralneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlan
    maaesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeq
    alefarkggtiditssidepvapaegiaravqagiplarvtlssngngsqpffddegnlt
    higvagfetlletvqvlvkdydfsisdalrpltssvagflnltgkgeilpgndadllvmt
    pelrieqvyargklmvkdgkacvkgtfet
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1ybqB (B:)
    midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
    cpgfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllakt
    ralneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlan
    maaesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeq
    alefarkggtiditssidepvapaegiaravqagiplarvtlssngngsqpffddegnlt
    higvagfetlletvqvlvkdydfsisdalrpltssvagflnltgkgeilpgndadllvmt
    pelrieqvyargklmvkdgkacvkgtfeta
    

    Sequence, based on observed residues (ATOM records):
    >1ybqB (B:)
    midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
    cpgfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllakt
    ralneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlan
    maaesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeq
    alefarkggtiditssidepvapaegiaravqagiplarvtlssngngsqpffddegnlt
    higvagfetlletvqvlvkdydfsisdalrpltssvagflnltgkgeilpgndadllvmt
    pelrieqvyargklmvkdgkacvkgtfet