PDB entry 1ybp

View 1ybp on RCSB PDB site
Description: Crystal structure of a protein with similarity to flavin-containing monooxygenases and to mammalian dimethylalanine monooxygenases
Deposited on 2004-12-21, released 2005-01-04
The last revision was dated 2005-01-11, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.226
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein with similarity to flavin-containing monooxygenases and to mammalian dimethylalanine monooxygenases
    Species: Schizosaccharomyces pombe
    Database cross-references and differences (RAF-indexed):
    • GB NP_595782
      • modified residue (98)
      • modified residue (378)
      • modified residue (387)
      • modified residue (434)
      • conflict (445)
  • Chain 'B':
    Compound: protein with similarity to flavin-containing monooxygenases and to mammalian dimethylalanine monooxygenases
    Species: Schizosaccharomyces pombe
    Database cross-references and differences (RAF-indexed):
    • GB NP_595782
      • modified residue (98)
      • modified residue (378)
      • modified residue (387)
      • modified residue (434)
      • conflict (445)
  • Heterogens: FAD, EPE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ybpA (A:)
    mslclptirkiaiigagpsglvtakallaekafdqvtlferrgspggvwnytstlsnklp
    vpstnpilttepivgpaalpvypsplyrdlqtntpielmgycdqsfkpqtlqfphrhtiq
    eyqriyaqpllpfiklatdvldiekkdgswvvtykgtkagspiskdifdavsicnghyev
    pyipnikgldeyakavpgsvlhsslfrepelfvgesvlvvggassandlvrhltpvakhp
    iyqsllgggdiqneslqqvpeitkfdpttreiylkggkvlsnidrviyctgylysvpfps
    laklkspetkliddgshvhnvyqhifyipdptlafvglalhvvpfptsqaqaaflarvws
    grlklpskeeqlkwqdelmfslsgannmyhsldypkdatyinklhdwckqatpvleeefp
    spywgekersirenmwsirakffgivppkeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1ybpA (A:)
    lptirkiaiigagpsglvtakallaekafdqvtlferrgspggvwnytstlsnklpvpst
    npilttepivgpaalpvypsplyrdlqtntpielmgycdqsfkpqtlqfphrhtiqeyqr
    iyaqpllpfiklatdvldiekkdgswvvtykgtkagspiskdifdavsicnghyevpyip
    nikgldeyakavpgsvlhsslfrepelfvgesvlvvggassandlvrhltpvakhpiyqs
    llgggdiqneslqqvpeitkfdpttreiylkggkvlsnidrviyctgylysvpfpslakl
    kspetkliddgshvhnvyqhifyipdptlafvglalhvvpfptsqaqaaflarvwsgrlk
    lpskeeqlkwqdelmfslsgannmyhsldypkdatyinklhdwckqatpvleeefpspyw
    gekersirenmwsirakffgiv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1ybpB (B:)
    mslclptirkiaiigagpsglvtakallaekafdqvtlferrgspggvwnytstlsnklp
    vpstnpilttepivgpaalpvypsplyrdlqtntpielmgycdqsfkpqtlqfphrhtiq
    eyqriyaqpllpfiklatdvldiekkdgswvvtykgtkagspiskdifdavsicnghyev
    pyipnikgldeyakavpgsvlhsslfrepelfvgesvlvvggassandlvrhltpvakhp
    iyqsllgggdiqneslqqvpeitkfdpttreiylkggkvlsnidrviyctgylysvpfps
    laklkspetkliddgshvhnvyqhifyipdptlafvglalhvvpfptsqaqaaflarvws
    grlklpskeeqlkwqdelmfslsgannmyhsldypkdatyinklhdwckqatpvleeefp
    spywgekersirenmwsirakffgivppkeghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1ybpB (B:)
    lptirkiaiigagpsglvtakallaekafdqvtlferrgspggvwnytstlsnklpvpst
    npilttepivgpaalpvypsplyrdlqtntpielmgycdqsfkpqtlqfphrhtiqeyqr
    iyaqpllpfiklatdvldiekkdgswvvtykgtkagspiskdifdavsicnghyevpyip
    nikgldeyakavpgsvlhsslfrepelfvgesvlvvggassandlvrhltpvakhpiyqs
    llgggdiqneslqqvpeitkfdpttreiylkggkvlsnidrviyctgylysvpfpslakl
    kspetkliddgshvhnvyqhifyipdptlafvglalhvvpfptsqaqaaflarvwsgrlk
    lpskeeqlkwqdelmfslsgannmyhsldypkdatyinklhdwckqatpvleeefpspyw
    gekersirenmwsirakffgiv