PDB entry 1ybo

View 1ybo on RCSB PDB site
Description: Crystal structure of the PDZ tandem of human syntenin with syndecan peptide
Class: structural protein
Keywords: PDZ domain, scaffolding protein, adhesion complex, STRUCTURAL PROTEIN
Deposited on 2004-12-21, released 2006-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Syntenin 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SDCBP, MDA9, SYCL
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00560 (5-165)
      • cloning artifact (3-4)
    Domains in SCOPe 2.07: d1yboa1, d1yboa2, d1yboa3
  • Chain 'B':
    Compound: Syntenin 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SDCBP, MDA9, SYCL
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00560 (5-End)
      • cloning artifact (1-4)
    Domains in SCOPe 2.07: d1ybob1, d1ybob2, d1ybob3
  • Chain 'C':
    Compound: syndecan-4
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: syndecan-4
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yboA (A:)
    gamdprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingenca
    gwssdkahkvlkqafgekitmtirdrpfertitmhkdstghvgfifkngkitsivkdssa
    arnglltehniceingqnviglkdsqiadilstsgtvvtitimpaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yboA (A:)
    dprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingencagws
    sdkahkvlkqafgekitmtirdrpfertitmhkdstghvgfifkngkitsivkdssaarn
    glltehniceingqnviglkdsqiadilstsgtvvtitimpaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yboB (B:)
    gamdprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingenca
    gwssdkahkvlkqafgekitmtirdrpfertitmhkdstghvgfifkngkitsivkdssa
    arnglltehniceingqnviglkdsqiadilstsgtvvtitimpaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yboB (B:)
    amdprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingencag
    wssdkahkvlkqafgekitmtirdrpfertitmhkdstghvgfifkngkitsivkdssaa
    rnglltehniceingqnviglkdsqiadilstsgtvvtitimpa
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.