PDB entry 1ybm

View 1ybm on RCSB PDB site
Description: X-ray structure of selenomethionyl gene product from Arabidopsis thaliana at5g02240 in space group P21212
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, CESG, PSI, Center for Eukaryotic Structural Genomics, NADP, UNKNOWN FUNCTION
Deposited on 2004-12-21, released 2005-01-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: unknown protein At5g02240
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g02240
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94EG6 (1-252)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d1ybma1, d1ybma2
  • Chain 'B':
    Compound: unknown protein At5g02240
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g02240
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94EG6 (1-252)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d1ybmb2, d1ybmb3
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ybmA (A:)
    sanlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditda
    dsinpafqgidalviltsavpkmkpgfdptkggrpefifedgqypeqvdwigqknqidaa
    kvagvkhivvvgsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldk
    eggvrellvgkddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptk
    dfkalfsqvtsrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybmA (A:)
    sanlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditda
    dsinpafqgidalviltsavpkmkpefifedgqypeqvdwigqknqidaakvagvkhivv
    vgsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldkeggvrellvg
    kddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptkdfkalfsqvt
    srf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ybmB (B:)
    sanlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditda
    dsinpafqgidalviltsavpkmkpgfdptkggrpefifedgqypeqvdwigqknqidaa
    kvagvkhivvvgsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldk
    eggvrellvgkddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptk
    dfkalfsqvtsrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybmB (B:)
    sanlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditda
    dsinpafqgidalviltsavpkmkpefifedgqypeqvdwigqknqidaakvagvkhivv
    vgsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldkeggvrellvg
    kddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptkdfkalfsqvt
    srf