PDB entry 1ybj

View 1ybj on RCSB PDB site
Description: Structural and Dynamics studies of both apo and holo forms of the hemophore HasA
Class: metal binding protein
Keywords: alpha+beta structure, curved anti-parallel beta-sheet, METAL BINDING PROTEIN
Deposited on 2004-12-21, released 2005-12-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-05-12, with a file datestamp of 2009-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemophore hasa
    Species: Serratia marcescens [TaxId:615]
    Gene: hasA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ybja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ybjA (A:)
    afsvnydssfggysihdylgqwastfgdvnhtngnvtdansggfyggslsgsqyaissta
    nqvtafvaggnltytlfnepahtlygqldslsfgdglsggdtspysiqvpdvsfgglnls
    slqaqghdgvvhqvvyglmsgdtgaletalngilddyglsvnstfdqvaaatavgvqh