PDB entry 1ybi

View 1ybi on RCSB PDB site
Description: Crystal structure of HA33A, a neurotoxin-associated protein from Clostridium botulinum type A
Class: toxin
Keywords: BETA-TREFOIL, toxin
Deposited on 2004-12-20, released 2005-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.169
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: non-toxin haemagglutinin HA34
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ybia1, d1ybia2
  • Chain 'B':
    Compound: non-toxin haemagglutinin HA34
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ybib1, d1ybib2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ybiA (A:)
    viqnslndkivtisckadtnlffyqvagnvslfqqtrnylerwrliydsnkaaykiksmd
    ihntnlvltwnapthnistqqdsnadnqywlllkdignnsfiiasyknpnlvlyadtvar
    nlklstlnnsnyikfiiedyiisdlnnftckispildlnkvvqqvdvtnlnvnlytwdyg
    rnqkwtiryneekaayqffntilsngvltwifsngntvrvsssndqnndaqywlinpvsd
    tdetytitnlrdttkaldlyggqtangtaiqvfnyhgddnqkwnirnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybiA (A:)
    slndkivtisckadtnlffyqvagnvslfqqtrnylerwrliydsnkaaykiksmdihnt
    nlvltwnapthnistqqdsnadnqywlllkdignnsfiiasyknpnlvlyadtvarnlkl
    stlnnsnyikfiiedyiisdlnnftckispildlnkvvqqvdvtnlnvnlytwdygrnqk
    wtiryneekaayqffntilsngvltwifsngntvrvsssndqnndaqywlinpvsdtdet
    ytitnlrdttkaldlyggqtangtaiqvfnyhgddnqkwnirnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ybiB (B:)
    viqnslndkivtisckadtnlffyqvagnvslfqqtrnylerwrliydsnkaaykiksmd
    ihntnlvltwnapthnistqqdsnadnqywlllkdignnsfiiasyknpnlvlyadtvar
    nlklstlnnsnyikfiiedyiisdlnnftckispildlnkvvqqvdvtnlnvnlytwdyg
    rnqkwtiryneekaayqffntilsngvltwifsngntvrvsssndqnndaqywlinpvsd
    tdetytitnlrdttkaldlyggqtangtaiqvfnyhgddnqkwnirnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybiB (B:)
    slndkivtisckadtnlffyqvagnvslfqqtrnylerwrliydsnkaaykiksmdihnt
    nlvltwnapthnistqqdsnadnqywlllkdignnsfiiasyknpnlvlyadtvarnlkl
    stlnnsnyikfiiedyiisdlnnftckispildlnkvvqqvdvtnlnvnlytwdygrnqk
    wtiryneekaayqffntilsngvltwifsngntvrvsssndqnndaqywlinpvsdtdet
    ytitnlrdttkaldlyggqtangtaiqvfnyhgddnqkwnirnp