PDB entry 1ybg

View 1ybg on RCSB PDB site
Description: MurA inhibited by a derivative of 5-sulfonoxy-anthranilic acid
Class: transferase/transferase inhibitor
Keywords: inside-out alpha-beta barrel, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2004-12-20, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-N-acetylglucosamine 1-carboxyvinyltransferase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: MURA, MURZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33038 (0-418)
      • engineered (66)
    Domains in SCOPe 2.07: d1ybga_
  • Chain 'B':
    Compound: UDP-N-acetylglucosamine 1-carboxyvinyltransferase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: MURA, MURZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33038 (0-418)
      • engineered (66)
    Domains in SCOPe 2.07: d1ybgb_
  • Chain 'C':
    Compound: UDP-N-acetylglucosamine 1-carboxyvinyltransferase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: MURA, MURZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33038 (0-418)
      • engineered (66)
    Domains in SCOPe 2.07: d1ybgc_
  • Chain 'D':
    Compound: UDP-N-acetylglucosamine 1-carboxyvinyltransferase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: MURA, MURZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33038 (0-418)
      • engineered (66)
    Domains in SCOPe 2.07: d1ybgd_
  • Heterogens: TAV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ybgA (A:)
    mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
    gtkverdgsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggcaigar
    pvdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtt
    iienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflv
    aaaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphp
    afptdmqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekl
    sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ybgB (B:)
    mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
    gtkverdgsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggcaigar
    pvdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtt
    iienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflv
    aaaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphp
    afptdmqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekl
    sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ybgC (C:)
    mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
    gtkverdgsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggcaigar
    pvdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtt
    iienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflv
    aaaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphp
    afptdmqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekl
    sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ybgD (D:)
    mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
    gtkverdgsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggcaigar
    pvdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtt
    iienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflv
    aaaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphp
    afptdmqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekl
    sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge