PDB entry 1ybf

View 1ybf on RCSB PDB site
Description: Crystal structure of AMP nucleosidase from Bacteroides thetaiotaomicron VPI-5482
Deposited on 2004-12-20, released 2005-01-04
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-04, with a file datestamp of 2005-01-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.228
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ybfa_
  • Chain 'B':
    Domains in SCOP 1.71: d1ybfb_
  • Chain 'C':
    Domains in SCOP 1.71: d1ybfc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ybfA (A:)
    mslktkqeivenwlprytqrqlidfepyilltnfshylhvfaehygvpivgehtsmpnas
    aegvtlinfgmgsanaatimdllwaihpkaviflgkcgglklenalgdyllpiaairgeg
    tsndylpeevpslpsfsvlraissaiqnkgkdywtgtvyttnrrvweydekfkdylrsth
    asgvdmetatlmtvgfankipmgalllisdrpmfpegvkteesdqlvtdnfaeehlmlgi
    daleiirenkssikhirfnweghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybfA (A:)
    tkqeivenwlprytqrqlidfepyilltnfshylhvfaehygvpivgehtsmpnasaegv
    tlinfgmgsanaatimdllwaihpkaviflgkcgglklenalgdyllpiaairgegtsnd
    ylpeevpslpsfsvlraissaiqnkgkdywtgtvyttnrrvweydekfkdylrsthasgv
    dmetatlmtvgfankipmgalllisdrpmfpegvkteesnfaeehlmlgidaleiirenk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ybfB (B:)
    mslktkqeivenwlprytqrqlidfepyilltnfshylhvfaehygvpivgehtsmpnas
    aegvtlinfgmgsanaatimdllwaihpkaviflgkcgglklenalgdyllpiaairgeg
    tsndylpeevpslpsfsvlraissaiqnkgkdywtgtvyttnrrvweydekfkdylrsth
    asgvdmetatlmtvgfankipmgalllisdrpmfpegvkteesdqlvtdnfaeehlmlgi
    daleiirenkssikhirfnweghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybfB (B:)
    tkqeivenwlprytqrqlidfepyilltnfshylhvfaehygvpivgehtsmpnasaegv
    tlinfgmgsanaatimdllwaihpkaviflgkcgglklenalgdyllpiaairgegtsnd
    ylpeevpslpsfsvlraissaiqnkgkdywtgtvyttnrrvweydekfkdylrsthasgv
    dmetatlmtvgfankipmgalllisnfaeehlmlgidaleiirenkss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ybfC (C:)
    mslktkqeivenwlprytqrqlidfepyilltnfshylhvfaehygvpivgehtsmpnas
    aegvtlinfgmgsanaatimdllwaihpkaviflgkcgglklenalgdyllpiaairgeg
    tsndylpeevpslpsfsvlraissaiqnkgkdywtgtvyttnrrvweydekfkdylrsth
    asgvdmetatlmtvgfankipmgalllisdrpmfpegvkteesdqlvtdnfaeehlmlgi
    daleiirenkssikhirfnweghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ybfC (C:)
    ktkqeivenwlprytqrqlidfepyilltnfshylhvfaehygvpivgehtsmpnasaeg
    vtlinfgmgsanaatimdllwaihpkaviflgkcgglalgdyllpiaairgegtsndylp
    eevpslpsfsvlraissaiqnkgkdywtgtvyttnrrvweydekfkdylrsthasgvdme
    tatlmtvgfankipmgalllisdrpmfpenfaeehlmlgidaleiirenk