PDB entry 1yb6

View 1yb6 on RCSB PDB site
Description: Hydroxynitrile lyase from hevea brasiliensis in complex with mandelonitrile
Class: lyase
Keywords: alpha-beta hydrolase fold; substrate complex; catalytic triad, lyase
Deposited on 2004-12-20, released 2005-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (s)-acetone-cyanohydrin lyase
    Species: Hevea brasiliensis [TaxId:3981]
    Gene: HNL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yb6a_
  • Heterogens: SO4, MNN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yb6A (A:)
    afahfvlihtichgawiwhklkpllealghkvtaldlaasgvdprqieeigsfdeysepl
    ltflealppgekvilvgescgglniaiaadkycekiaaavfhnsvlpdtehcpsyvvdkl
    mevfpdwkdttyftytkdgkeitglklgftllrenlytlcgpeeyelakmltrkgslfqn
    ilakrpfftkegygsikkiyvwtdqdeiflpefqlwqienykpdkvykveggdhklqltk
    tkeiaeilqevadtyn